254781205

254781205

hypothetical protein CLIBASIA_05560

GeneID in NCBI database:8210230Locus tag:CLIBASIA_05560
Protein GI in NCBI database:254781205Protein Accession:YP_003065618.1
Gene range:-(1205310, 1205825)Protein Length:171aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MSIGMDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDREDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGWHRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS
ccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHccccHHHccHHHHHHHHHHHHcccccccc
ccccHHHHHHHHccccccccccEEEcccHHccccccccHHHHHHHHHHHHHHHHEEEccHHHHHHHccccccccEEEEEEEcccccccHHHHcccccHHHHHcHcHHHHHHHHHHHHHHHHccccHccHHHHHcccHHHHHHHcccccHccccHHHHHHHHEEcccccccc
msigmddllyglslasplvgagLRISSTLashrssirdHEYRSLLAEENALRADVLYLDREDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGWhrankeavknnrwasvaaiagppmvesassAGMKMFRrynvkgkdas
MSIGMDDLLYGLSLASPLVGAGLRISSTlashrssiRDHEYRSLLAEENALRADVLYLDREDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEagwhrankeavknnrwasvaaiagppmvesassagmkMFRRYNVKGKDAS
MSIGMDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDREDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGWHRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS
***GMDDLLYGLSLASPLVGAGLRIS*************************RADVLYL***********M****F**********GASLDLLVGQNTRNA***************ARFAK**************NRWASVAAIAGPPMVESA*SAGMKMFRR**V******
MSIGMDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDREDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGWHRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS
*SIGMDDLLYGLSLASPLVGAGLRIS******RSSIRDHEYRSLLAEENALRADVLYLDREDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGWHRANKEAVKNNRWASVAAIAGPPMVESAS****K*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIGMDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDREDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGWHRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target171 hypothetical protein CLIBASIA_05560 [Candidatus Liberib
317120671167 hypothetical protein SC1_gp050 [Liberibacter phage SC1] 1 1e-91
315121930148 hypothetical protein CKC_00900 [Candidatus Liberibacter 1 3e-16
31512242583 hypothetical protein CKC_03385 [Candidatus Liberibacter 1 1e-08
317120713118 hypothetical protein SC2_gp065 [Liberibacter phage SC2] 2 1e-05
>gi|317120671|gb|ADV02494.1| hypothetical protein SC1_gp050 [Liberibacter phage SC1] Length = 167 Back     alignment and organism information
 Score =  338 bits (868), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 167/167 (100%), Positives = 167/167 (100%)

Query: 5   MDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDREDQA 64
           MDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDREDQA
Sbjct: 1   MDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDREDQA 60

Query: 65  RREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGW 124
           RREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGW
Sbjct: 61  RREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGW 120

Query: 125 HRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS 171
           HRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS
Sbjct: 121 HRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS 167


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315121930|ref|YP_004062419.1| hypothetical protein CKC_00900 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 148 Back     alignment and organism information
>gi|315122425|ref|YP_004062914.1| hypothetical protein CKC_03385 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 83 Back     alignment and organism information
>gi|317120713|gb|ADV02535.1| hypothetical protein SC2_gp065 [Liberibacter phage SC2] Length = 118 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00