254781206

254781206

hypothetical protein CLIBASIA_05565

GeneID in NCBI database:8210231Locus tag:CLIBASIA_05565
Protein GI in NCBI database:254781206Protein Accession:YP_003065619.1
Gene range:-(1205806, 1209546)Protein Length:1246aa
Gene description:hypothetical protein
COG prediction:[N] [T] Methyl-accepting chemotaxis protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------
MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANERYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGEFEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG
cccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHcccccccccHHHHccHHHHcccccccccccEEHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEHHHHcccccccEEEEEccccHHccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcHHHHHHHHHHHccccHHEEccHHHccHHHHHccccHHHHHHHHHHHccccccccccccccccccEEHHHcccHHHHcccccccHHHHHHHHHHHcccccccEEEcccccccHHHHcccccHHHHcccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHccccccccEEEEEcccccccHHEEEEEccccEEEEEEEcccccccccHHHcccc
cccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHEHccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHcHHHHcccccEEEccccccccEccccccccccccHHHHHHccccccccccccccccccccccccccccEEccccccccccccccccccccccccccHHccccccccccHccccccHHHcccccHHHcccEEccHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccEEEEHHHHcccccccccEEHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccEEEEEHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccHHHHcccccccccccccccccccccHHHHHHEHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccEcccccccHHHHHHHHHHHHcccccHEHHHHHHHcccccccccccccccccHHHccccHHHHHHHHHHHHHccHcccccccccccccEEEEEcccccccccccccccEHHHHHcccccccccccEEEEcccccHHHcccccccccccccccccEEEEEccccccccccccccccEEEEEEEEEEEEcccEEEEEcccccccHHHHcccccccEEEEEEccccccccHEEEEEccccEEEEEEEEEccccccccEEcccc
MNELATSIDyqtnnldqdkipsedVAKTLTSIQDNIKHLREFIIAWssdlnphkdrydyivGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVgtklkentppttfTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQkeydesekgsskARYHAAYAHIYWDLAndwvngrvgdksdewarTSTNIASWIGRitrteglggvtyDQIKQLRDLASKVKADYHWAeirhgnrfkaeTRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADkdlqektpikaegddfglglpsvpthsvklppkeeeLEEVKdegkkgkepgttetddreeterknqdildnsllagkthtknetpaiptakappaqahkgiqdkkpqdqrekplasdigvgesdyagikLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYrsyspvdgsykgtqesDKAINHfldndfgyyrihnflsqwsplglmyekdelHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRrlvkedpkrgksesYLSDIRSELQKVNKTVMDIRIKLRLYGifqdipqeqpplytiisgsekilqgdytfpplssldvqskfdSSYSKLFEIFYgdwtnnaikeeRYWTIYAFERSLKNQAHLNAEVERlsglaqqpsdstADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADakenpnpnknqKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFkasfeyplgtyepaILGAMKdmdrlhpiysVSKTiqkaggdpslmmdyekvepsdvmaglPDDLAKRFKALLSWkgwhqltpapkistpsfevssyvnpkrmhadtesDIYFEEFKRslsswedeprieverdatlprlakddgskedeyegganeryvcipsmdtsesfnstmgkkrRIFKVVVRVINTADLevgilgfpivpveelrgkpktgefevlvpsdaslnpeiiirqktggyfCLTSITahtqfegeryehrhg
MNELATsidyqtnnldqdkipSEDVAKTLTSIQDNIKHLREFIIAwssdlnphkdryDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRlaetgevilsdksdrLLCRFMDMVEtedehkinKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAidvgtklkentppTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRVGdksdewartstniaswigritrteglggvtYDQIKQLRDLASKVKADYHWAEirhgnrfkaeTRLAYSTIANVANFTSELKQATVLARANAQEEKQRReqeakekadrekadkeakekadrekadkdlqektpikaegddfglglpsvpthsvklppkeeeleevkdegkkgkepgttetddreeterknqdildnsllagkthtknetpaiptakappaqahkgiqdkkpqdqrekplasdigvgesdyaGIKLTKKEKELQEQEENLRVAEiiqqsrmqsedLQEKAWDSYKewkslspdeIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFevlsskhqksviaVNNFIKEithhtrrlvkedpkrgksesylsdIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIfygdwtnnaIKEERYWTIYAFERSLKNQAHLNAEVERLSglaqqpsdstadLKELQTQLSrakkykesnderiVSFIRSEFEREIKELKSVieadakenpnpnknqkklqKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHqltpapkistpsfEVSSYVNPKRMHADTESDIYFEEFKRslsswedeprieverdatlprlakddgskedeyegganeryvcipsmdtsesfnstmgkkrriFKVVVRVINTAdlevgilgfpivpveelrgkpKTGEfevlvpsdaslnPEIIIRQKTGGYFCLTSITahtqfegeryehrhg
MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLaranaqeekqrreqeakekadrekadkeakekadrekadkdLQEKTPIKAEGDDFGLGLPSVPTHSvklppkeeeleevkdegkkgkepgttetddreeterKNQDILDNSLLAGKTHTKNETpaiptakappaqaHKGIQDKKPQDQREKPLASDIGVGESDYAGIkltkkekelqeqeeNLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKEnpnpnknqkklqkTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANERYVCIPSMDTSESFNSTMGkkrrifkvvvrviNTADLEVGILGFPIVPVEELRGKPKTGEFEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG
****ATS*DYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELA*********HIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKE*********************AAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQL*******************************************************************************************************************************************************************************************************************************************************************************QKYAKVFYRS*******************HFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVD********************************NNFIKEITHH************************LQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDV*****SSYSKLFEIFYGDWTNNAIKEERYWTIYAFE****************************************************SFIRSEFE*****************************************LKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQK*GGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTP**********V****************IYFEEFKR**********IEVERDA******************GANERYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGEFEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQF**********
MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNH*************ARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLA*****************************************QEKTPIKAEGDDFGLGLPSVPTHSVKLPPK*******************************NQDILDNSLLAGKTHTKNETPAIPT*************************ASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQS**********AWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAM*********************KHQKSVIAVNNFIKEITHHTRR*************YLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQ***********DERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAK***********GANERYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGEFEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFE*********
**ELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQR******************************LQEKTPIKAEGDDFGLGLPS**************************************************LLAG************************************P******VGESDYAGIKLTKKEKELQEQEENLRVAEIIQQ******DLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKA**********HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGL****SDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVNPKRM**DT*SDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANERYVCIPS******F****GKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGEFEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGE*Y*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKxxxxxxxxxxxxxxxxxxxxxSSKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKxxxxxxxxxxxxxxxxxxxxxQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIxxxxxxxxxxxxxxxxxxxxxNPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANERYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGEFEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1246 hypothetical protein CLIBASIA_05565 [Candidatus Liberib
3171206721340 hypothetical protein SC1_gp060 [Liberibacter phage SC1] 1 0.0
315121931327 hypothetical protein CKC_00905 [Candidatus Liberibacter 1 1e-18
315122424101 hypothetical protein CKC_03380 [Candidatus Liberibacter 1 2e-17
317120714413 hypothetical protein SC2_gp070 [Liberibacter phage SC2] 1 9e-04
31512242386 hypothetical protein CKC_03375 [Candidatus Liberibacter 1 0.003
3288700171814 hypothetical protein DFA_03886 [Dictyostelium fascicula 2 7e-09
308457811616 hypothetical protein CRE_26828 [Caenorhabditis remanei] 2 7e-06
308457811616 hypothetical protein CRE_26828 [Caenorhabditis remanei] 2 6e-05
224122178 1681 predicted protein [Populus trichocarpa] Length = 1681 2 1e-05
328870962 1641 villin [Dictyostelium fasciculatum] Length = 1641 2 2e-05
>gi|317120672|gb|ADV02495.1| hypothetical protein SC1_gp060 [Liberibacter phage SC1] Length = 1340 Back     alignment and organism information
 Score = 2574 bits (6672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1246/1246 (100%), Positives = 1246/1246 (100%)

Query: 1    MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
            MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI
Sbjct: 95   MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 154

Query: 61   VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL 120
            VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL
Sbjct: 155  VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL 214

Query: 121  CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ 180
            CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ
Sbjct: 215  CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ 274

Query: 181  KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA 240
            KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA
Sbjct: 275  KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA 334

Query: 241  ELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLAN 300
            ELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLAN
Sbjct: 335  ELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLAN 394

Query: 301  DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE 360
            DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE
Sbjct: 395  DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE 454

Query: 361  IRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD 420
            IRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD
Sbjct: 455  IRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD 514

Query: 421  KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG 480
            KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG
Sbjct: 515  KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG 574

Query: 481  KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ 540
            KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ
Sbjct: 575  KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ 634

Query: 541  DQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            DQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS
Sbjct: 635  DQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 694

Query: 601  YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 660
            YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF
Sbjct: 695  YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 754

Query: 661  LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK 720
            LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK
Sbjct: 755  LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK 814

Query: 721  HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVM 780
            HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVM
Sbjct: 815  HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVM 874

Query: 781  DIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFE 840
            DIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFE
Sbjct: 875  DIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFE 934

Query: 841  IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL 900
            IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL
Sbjct: 935  IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL 994

Query: 901  SRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQ 960
            SRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQ
Sbjct: 995  SRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQ 1054

Query: 961  LSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQ 1020
            LSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQ
Sbjct: 1055 LSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQ 1114

Query: 1021 KAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSY 1080
            KAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSY
Sbjct: 1115 KAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSY 1174

Query: 1081 VNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANE 1140
            VNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANE
Sbjct: 1175 VNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANE 1234

Query: 1141 RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGE 1200
            RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGE
Sbjct: 1235 RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGE 1294

Query: 1201 FEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG 1246
            FEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG
Sbjct: 1295 FEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG 1340


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315121931|ref|YP_004062420.1| hypothetical protein CKC_00905 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 327 Back     alignment and organism information
>gi|315122424|ref|YP_004062913.1| hypothetical protein CKC_03380 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 101 Back     alignment and organism information
>gi|317120714|gb|ADV02536.1| hypothetical protein SC2_gp070 [Liberibacter phage SC2] Length = 413 Back     alignment and organism information
>gi|315122423|ref|YP_004062912.1| hypothetical protein CKC_03375 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 86 Back     alignment and organism information
>gi|328870017|gb|EGG18392.1| hypothetical protein DFA_03886 [Dictyostelium fasciculatum] Length = 1814 Back     alignment and organism information
>gi|308457811|ref|XP_003091269.1| hypothetical protein CRE_26828 [Caenorhabditis remanei] Length = 616 Back     alignment and organism information
>gi|308457811|ref|XP_003091269.1| hypothetical protein CRE_26828 [Caenorhabditis remanei] Length = 616 Back     alignment and organism information
>gi|224122178|ref|XP_002330559.1| predicted protein [Populus trichocarpa] Length = 1681 Back     alignment and organism information
>gi|328870962|gb|EGG19334.1| villin [Dictyostelium fasciculatum] Length = 1641 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1246 hypothetical protein CLIBASIA_05565 [Candidatus Liberib
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.002
PRK09510387 PRK09510, tolA, cell envelope integrity inner membrane 0.003
KOG10291118 KOG1029, KOG1029, KOG1029, Endocytic adaptor protein in 0.004
>gnl|CDD|163023 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|181920 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|36247 KOG1029, KOG1029, KOG1029, Endocytic adaptor protein intersectin [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1246 hypothetical protein CLIBASIA_05565 [Candidatus Liberib
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated PIT, 0.004
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
 Score = 39.9 bits (92), Expect = 0.004
 Identities = 17/80 (21%), Positives = 42/80 (52%), Gaps = 13/80 (16%)

Query: 553 VGESDYAGIKLTKKEKELQE--QEENLRVAEIIQQSRMQSEDLQEKAWDSYKEW-----K 605
           + ++D    +LT++ + +++  +E+  R+ E+   S++  ++ +EKA    +EW     +
Sbjct: 74  IAQAD----RLTQEPESIRKWREEQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSE 129

Query: 606 SLSPDEIKQRFQKYAKVFYR 625
            +  ++I  R     K FY+
Sbjct: 130 QVEKNKINNRIAD--KAFYQ 147


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00