254781207

254781207

hypothetical protein CLIBASIA_05570

GeneID in NCBI database:8210232Locus tag:CLIBASIA_05570
Protein GI in NCBI database:254781207Protein Accession:YP_003065620.1
Gene range:-(1209585, 1209827)Protein Length:80aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80
MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEKKLLKKGLKKRQKNY
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccHHEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEKKLLKKGLKKRQKNY
MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEKKllkkglkkrqkny
MGFWNSITSIaatvgavvgtvataaalatPIGWvgaavagvgaavvgagaSDLAMHKMreqeeeekkllkkglkkrqkNY
*GFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASD****************************
MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMH************************
*GFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEKKLLKKGLKKR****
iHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooo
MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMxxxxxxxxxxxxxxxxxxxxxY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target80 hypothetical protein CLIBASIA_05570 [Candidatus Liberib
317120672 1340 hypothetical protein SC1_gp060 [Liberibacter phage SC1] 1 2e-07
>gi|317120672|gb|ADV02495.1| hypothetical protein SC1_gp060 [Liberibacter phage SC1] Length = 1340 Back     alignment and organism information
 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 63/84 (75%), Positives = 66/84 (78%), Gaps = 13/84 (15%)

Query: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMH---- 56
          MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMH    
Sbjct: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60

Query: 57 ---------KMREQEEEEKKLLKK 71
                   + R +EE EK L+ K
Sbjct: 61 QEEEEKKASEKRIKEETEKLLISK 84


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00