254781208

254781208

hypothetical protein CLIBASIA_05575

GeneID in NCBI database:8210233Locus tag:CLIBASIA_05575
Protein GI in NCBI database:254781208Protein Accession:YP_003065621.1
Gene range:-(1209852, 1211588)Protein Length:578aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MVNTTWTKHSFSAGELSPRLLQSRKDLSLHAQGVAKSRNLIPLRYGPLVSMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRSSTKWSPALFGKTYKTPYTFKDNKSLEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKLSISQADTSTARITSDMKIFKPLDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRSLTTGRSGDRFGYSKGATYVKDNNITWITVLNLSSKTSRESASGAVAPYYVWGDIKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGDELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSLWLLSISLSKGLSIDFRRVSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNEITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMISDKHYVLSAASFPNDNRGGTSLWMLVALSAGEERSFTVRLNLLDDFK
ccccEEEccccccccccHHHHHcccccEEEEccccccccEEEEEcccccccHHHHHHHHccccccccEEEEEEcccccEEEEEEcccEEEEEEEEccccccHHHccccccccEEEccccEEEEEEEccEEEEEEcccccEEEEEEEcccEEEEEEHHEEEcccccccccHHcccccccEEEEEEcccccEEEEcccHHccccccccEEEEEccccHHcccccccEEEEEEEccHHEHHHcccccccccccccccEEEEcccEEEEEEEEEcccccccccccccccEEEEEcHHHccccccEEEEccccHHHHHccccEEEEEcccccccccccEEEEEEEEEEEccccccccEEEEEEHHHHHHcEEccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccEEEEEEcccEEEEEccccccccEEEEEccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccEEEEEEEcccccEEEEEcccccccccEEEEEEEEcccccccEEEEEEHHHHcccEEEEEEEEccccccc
cccccccccccccccccHHHHHcHHHHHHHHHHHHHHHccccccccccccccccHHHHHcccccccEEEEEEccccHHHHHHHcccccEEEEEEccccEccHcccccEEcccccHHHHHcccEcccccEEEEEcccccHHHHcccccccEEEccccccccccccHccccccccccccEEEEEEcccccEEEEcccHHHccccHcccEEEEccccccccccHHcccccEEEcccHEEEEEccccccccccccccEEEcccccEEEEEEccHHHHHHHccccEEEEEEEEccccccccccccEEEEcccccEEcccccccHHHHHHHcccccccccEEEEEHcEEEEEcccccccEEEEEcccccccccccccccccccccccccEEEEEccccEEEEEEccccEEEEEcccEEEEEcccccEEEEEEEEEccccccccccccccccEEEEEccccEEEEEEEcccccccccHHHHHHHHHHHccccEHHHccccccEEEEEEEcccccHHHHHEEEEccccccEEEEEEEcccccEEEEEEEEccccccccEEEEEEEEccccccccHEEEEccHHccc
mvnttwtkhsfsagelsprLLQSRKDLSLHAQgvaksrnliplrygplvsmplmqeyrdcrldprsnrvfsfsipdggYALLVFGDKKLQIVVVRSstkwspalfgktyktpytfkdnksleyavfgstavfvhkdhpphhllyiqdgdkisftfdeikflpppwlgdgmisgvksnaklsisqadtstaritsdmkifkpldkgrsirlgchppewakntnysIGAYIVADDKVYrslttgrsgdrfgyskgatyvkdnnITWITVLNLssktsresasgavapyyvwgdikdvskdgrsisvapqsqtlFQAGVSVVSWFMSawgeqegypshvtfhnnrllfsgskgdeLSVYLSSFgafydfsldgeygcydptkalTTAVTDfsastihwmhpfgegvlvGCDTSLWLLSISLSkglsidfrrvsgsgvyacppvsvgdCLVFVCGVgrrikyisgsteqgfrfNEITQLADHLFNQRILQLVYQEEPHSIVWVVlepkdnsfprllgcrfsaegegdfawhthmisdkhyvlsaasfpndnrggtSLWMLVALSAGEERSFTVRLNLLDDFK
mvnttwtkhsfsagelspRLLQSRKDLSLHaqgvaksrnliplrygPLVSMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRsstkwspalfgktyktpytfkdnKSLEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKLSisqadtstaritsdmkifkplDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRSLTtgrsgdrfgyskgatyvkdnnitWITVLNlssktsresasgavapyyvWGDIKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGDELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSLWLLSISLSKGLSIDFRRVSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNEITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMISDKHYVLSAASFPNDNRGGTSLWMLVALsageersftvrlnllddfk
MVNTTWTKHSFSAGELSPRLLQSRKDLSLHAQGVAKSRNLIPLRYGPLVSMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRSSTKWSPALFGKTYKTPYTFKDNKSLEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKLSISQADTSTARITSDMKIFKPLDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRSLTTGRSGDRFGYSKGATYVKDNNITWITVLNLSSKTSRESASGAVAPYYVWGDIKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGDELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTslwllsislskglsIDFRRVSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNEITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMISDKHYVLSAASFPNDNRGGTSLWMLVALSAGEERSFTVRLNLLDDFK
****TWTKHSFSAGELSPRLLQSRKDLSLHAQGVAKSRNLIPLRYGPLVSMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRSSTKWSPALFGKTYKTPYTFKDNKSLEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKLSISQADTSTARITSDMKIFKPLDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRSLTTGRSGDRFGYSKGATYVKDNNITWITVLNLSSKTSRESASGAVAPYYVWGDIKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGDELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSLWLLSISLS****IDF**VSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNEITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMISDKHYVLSAASFPNDNRGGTSLWMLVALSAGEERSFTVRLNLL****
MVNTTWTKHSFSAGELSPRLLQSRKDLSLHAQGVAKSRNLIPLRYGPLVSMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRSSTKWSPALFGKTYKTPYTFKDNKSLEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKLSISQADTSTARITSDMKIFKPLDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRSLTTGRSGDRFGYSKGATYVKDNNITWITVLNLSS********GAVAPYYVWGDIKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGDELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSLWLLSISLSKGLSIDFRRVSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNEITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMISDKHYVLSAASFPNDNRGGTSLWMLVALSAGEERSFTVRLNLLDDFK
****TWTKHSFSAGELSPRLLQSRKDLSLHAQGVAKSRNLIPLRYGPLVSMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRSSTKWSPALFGKTYKTPYTFKDNKSLEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKLSISQADTSTARITSDMKIFKPLDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRSLTTGRSGDRFGYSKGATYVKDNNITWITVLNLSSKTSRESASGAVAPYYVWGDIKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGDELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSLWLLSISLSKGLSIDFRRVSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNEITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMISDKHYVLSAASFPNDNRGGTSLWMLVALSAGEERSFTVRLNLLDDFK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNTTWTKHSFSAGELSPRLLQSRKDLSLHAQGVAKSRNLIPLRYGPLVSMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRSSTKWSPALFGKTYKTPYTFKDNKSLEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKLSISQADTSTARITSDMKIFKPLDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRSLTTGRSGDRFGYSKGATYVKDNNITWITVLNLSSKTSRESASGAVAPYYVWGDIKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGDELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSLWLLSISLSKGLSIDFRRVSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNEITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMISDKHYVLSAASFPNDNRGGTSLWMLVALSAGEERSFTVRLNLLDDFK
MVNTTWTKHSFSAGELSPRLLQSRKDLSLHAQGVAKSRNLIPLRYGPLVSMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRSSTKWSPALFGKTYKTPYTFKDNKSLEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKLSISQADTSTARITSDMKIFKPLDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRSLTTGRSGDRFGYSKGATYVKDNNITWITVLNLSSKTSRESASGAVAPYYVWGDIKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGDELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSLWLLSISLSKGLSIDFRRVSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNEITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMISDKHYVLSAASFPNDNRGGTSLWMLVALSAGEERSFTVRLNLLDDFK
MVNTTWTKHSFSAGELSPRLLQSRKDLSLHAQGVAKSRNLIPLRYGPLVSMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRSSTKWSPALFGKTYKTPYTFKDNKSLEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKLSISQADTSTARITSDMKIFKPLDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRSLTTGRSGDRFGYSKGATYVKDNNITWITVLNLSSKTSRESASGAVAPYYVWGDIKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGDELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSLWLLSISLSKGLSIDFRRVSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNEITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMISDKHYVLSAASFPNDNRGGTSLWMLVALSAGEERSFTVRLNLLDDFK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target578 hypothetical protein CLIBASIA_05575 [Candidatus Liberib
315122895588 hypothetical protein CKC_05755 [Candidatus Liberibacter 1 1e-115
315121933588 hypothetical protein CKC_00915 [Candidatus Liberibacter 1 1e-115
317120716590 hypothetical protein SC2_gp080 [Liberibacter phage SC2] 1 2e-53
227355852 820 conserved hypothetical protein [Proteus mirabilis ATCC 1 2e-19
268589382 818 hypothetical protein PROVRETT_05514 [Providencia rettge 1 3e-18
48697202 768 hypothetical protein BcepC6B_gp12 [Burkholderia phage B 1 1e-17
212710810 818 hypothetical protein PROVALCAL_01878 [Providencia alcal 1 1e-17
221213947 766 conserved hypothetical protein [Burkholderia multivoran 1 2e-17
221201505 767 conserved hypothetical protein [Burkholderia multivoran 1 3e-17
288959382 665 hypothetical protein AZL_025410 [Azospirillum sp. B510] 1 2e-15
>gi|315122895|ref|YP_004063384.1| hypothetical protein CKC_05755 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 588 Back     alignment and organism information
 Score =  422 bits (1084), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 222/567 (39%), Positives = 337/567 (59%), Gaps = 23/567 (4%)

Query: 1   MVNTTWTKHSFSAGELSPRLLQSRKDLSLHAQGVAKSRNLIPLRYGPLVSMPLMQEYRDC 60
           M    +TK SF+ GE+SP+++QSR DL LH+QG+++  N+IPL+ G LV  P +  Y   
Sbjct: 1   MPKGAYTKRSFAGGEVSPQIMQSRSDLELHSQGLSQCFNMIPLQDGSLVRRPPLYRYEHI 60

Query: 61  RLDPRSNRVFSFSIPDGGYALLVFGDKKLQIVVVRSSTKWSPALFGKTYKTPYTFKDNKS 120
            L P+++R+ SF++      L +FG+KK+  V V   T   P  F + Y TPY+F++ + 
Sbjct: 61  DLPPKASRILSFALGGDDAVLFIFGEKKMVYVEV---TGIKPPQFIRFYDTPYSFREAEQ 117

Query: 121 LEYAVFGSTAVFVHKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISGVKSNAKL 180
           L+ A  G+  V VH  H P+ + + + G      F+++ F PPPWLG   + G K +AKL
Sbjct: 118 LDVARMGTLIVLVHPKHSPYKIEFTEAG----VIFEKMVFAPPPWLGLREVGGKKHDAKL 173

Query: 181 SISQADTSTARIT--SDMKIFKPLDKGRSIRLGCHPPEWAKNTNYSIGAYIVADDKVYRS 238
            ++ + T   +IT  S + IFK  D GR +RLG  P +W  NT Y   A++    KVYR 
Sbjct: 174 RVTLSATRKGKITVTSTLPIFKTKDVGRMLRLGWLPKDWTANTLYPENAFMQMYGKVYRC 233

Query: 239 LTTGRSGDRFGYSKGATYVKDNNITWITV-------LNLSSKTSRESASGAVAPYYVWGD 291
           +T G SG  F  ++  TY++D  +TW  +       ++   K++  +      PYYVWG+
Sbjct: 234 ITEGISGKEFEDNRRDTYIRDGGVTWKVIASSQALSVDKDGKSTLGTGGQYRTPYYVWGE 293

Query: 292 IKDVSKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGD 351
           I + +   +++ V            S + W MSAWGE+EGYPSHV+F+NNRL FSGSK D
Sbjct: 294 IVNCT-GAKTVEVMLHEGFCVTDSNSTLYWNMSAWGEREGYPSHVSFYNNRLCFSGSKFD 352

Query: 352 ELSVYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSL 411
             +VY S +  F DFS D   G  D  K+L+ A+TD + S I W  P  +G+++G DTSL
Sbjct: 353 PQAVYFSGYNTFTDFSPDTIEGNVDYRKSLSVAITDDTMSAIRWFRPMEKGLVIGTDTSL 412

Query: 412 WLLSISLSKGLSIDFRRVSGSGVYACPPVSVGDCLVFVCGVGRRIKYISGSTEQGFRFNE 471
           W++ +   +G ++  RR++G GVY  PP+S+GD L+FV G GRRI+ I G++EQGF+F E
Sbjct: 413 WIVILDFERGFNLVSRRLAGIGVYEAPPLSIGDELIFVQGAGRRIQIIGGASEQGFQFLE 472

Query: 472 ITQLADHLFNQRILQLVYQEEPHSIVWVVLEPKDNSFPRLLGCRFSAEGEGDFAWHTHMI 531
           +TQ  DHL + RI QL YQE+P+S++WV+     N+   LLGC   A  +   +WH H +
Sbjct: 473 LTQNVDHLLDYRIRQLAYQEDPYSLLWVL-----NNKGELLGCSLHANSKEKGSWHVHKL 527

Query: 532 SDKHY-VLSAASFPNDNRGGTSLWMLV 557
             +   ++S +S    ++G T++W+L+
Sbjct: 528 GGRGVKIMSLSSCLCLDQGETTVWLLL 554


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121933|ref|YP_004062422.1| hypothetical protein CKC_00915 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 588 Back     alignment and organism information
>gi|317120716|gb|ADV02538.1| hypothetical protein SC2_gp080 [Liberibacter phage SC2] Length = 590 Back     alignment and organism information
>gi|227355852|ref|ZP_03840245.1| conserved hypothetical protein [Proteus mirabilis ATCC 29906] Length = 820 Back     alignment and organism information
>gi|268589382|ref|ZP_06123603.1| hypothetical protein PROVRETT_05514 [Providencia rettgeri DSM 1131] Length = 818 Back     alignment and organism information
>gi|48697202|ref|YP_024932.1| hypothetical protein BcepC6B_gp12 [Burkholderia phage BcepC6B] Length = 768 Back     alignment and organism information
>gi|212710810|ref|ZP_03318938.1| hypothetical protein PROVALCAL_01878 [Providencia alcalifaciens DSM 30120] Length = 818 Back     alignment and organism information
>gi|221213947|ref|ZP_03586920.1| conserved hypothetical protein [Burkholderia multivorans CGD1] Length = 766 Back     alignment and organism information
>gi|221201505|ref|ZP_03574544.1| conserved hypothetical protein [Burkholderia multivorans CGD2M] Length = 767 Back     alignment and organism information
>gi|288959382|ref|YP_003449723.1| hypothetical protein AZL_025410 [Azospirillum sp. B510] Length = 665 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target578 hypothetical protein CLIBASIA_05575 [Candidatus Liberib
PHA00661 734 PHA00661, PHA00661, hypothetical protein 5e-31
>gnl|CDD|106970 PHA00661, PHA00661, hypothetical protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 578 hypothetical protein CLIBASIA_05575 [Candidatus Liberib
PHA00661 734 hypothetical protein 100.0
>PHA00661 hypothetical protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00