254781209

254781209

hypothetical protein CLIBASIA_05580

GeneID in NCBI database:8210234Locus tag:CLIBASIA_05580
Protein GI in NCBI database:254781209Protein Accession:YP_003065622.1
Gene range:-(1211581, 1212108)Protein Length:175aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPLYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGYHNG
ccccEEccHHHHHHcccccccccccccccHHEEEEccHHHHHHHHHccHHEEccccEEEEEEEEEcccEEEEEEHHHHHHHccccccEEEEEEEEEEccccccEEEEEEEccccccccHHHHHHHHHHHHccccccEEEcHHHHHHHcccccEEEEEEEcccccccccccccccc
ccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccEccccccEEEEEcccccccccccEEEccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHcHcccccHHHHHHHHcccHHHHHHHHHHcccccccccccccc
MTELEICNWALLKlgqrplenwnerslkadycrlllppihkgllrsfswsfatqsmdllplyftyngelkyyiplkcLKVLNTSEETQLRGRcivargdtprplslkyigevplsdcdpLYQEAFALKLAgelcpplimddqMRSYLKGESERVLAVAMDmdgveipedrgyhng
MTELEICNWAllklgqrpleNWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPLYFTYNGELKYYIPLKCLKVLNTSeetqlrgrcivargdtprplSLKYIGEVPLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMdmdgveipedrgyhng
MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPLYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGYHNG
MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPLYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPLYQEAFALKLAGELCPPLIM*******LKGESERVL********************
MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPLYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGYHNG
MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPLYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVE**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPLYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGYHNG
MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPLYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGYHNG
MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPLYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGYHNG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target175 hypothetical protein CLIBASIA_05580 [Candidatus Liberib
315121934172 hypothetical protein CKC_00920 [Candidatus Liberibacter 1 2e-52
315122896172 hypothetical protein CKC_05760 [Candidatus Liberibacter 1 7e-49
317120717172 hypothetical protein SC2_gp085 [Liberibacter phage SC2] 1 1e-19
221201504207 conserved hypothetical protein [Burkholderia multivoran 1 1e-10
221213948207 conserved hypothetical protein [Burkholderia multivoran 1 3e-10
332160973186 hypothetical protein YE105_C1351 [Yersinia enterocoliti 1 2e-09
296532339189 conserved hypothetical protein [Roseomonas cervicalis A 1 5e-09
187736541206 hypothetical protein Amuc_2062 [Akkermansia muciniphila 1 6e-09
48697201207 hypothetical protein BcepC6B_gp11 [Burkholderia phage B 1 7e-09
242278912197 hypothetical protein Desal_1440 [Desulfovibrio salexige 1 3e-06
>gi|315121934|ref|YP_004062423.1| hypothetical protein CKC_00920 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 172 Back     alignment and organism information
 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 124/172 (72%)

Query: 1   MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLP 60
           MTE EICNWALLKLGQRP+   +E S+KA YC+ LL PIH+ LLRSF+W FAT+S  L  
Sbjct: 1   MTECEICNWALLKLGQRPIAKLDEGSIKAKYCKFLLSPIHRSLLRSFAWGFATKSSFLSS 60

Query: 61  LYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPL 120
           L     G ++Y +P KCLKVL    +  L G CIV   +   PLS+KYI EV L+DCDPL
Sbjct: 61  LVSEDQGRVRYPLPKKCLKVLKIDRDGILDGDCIVVHDNKSIPLSIKYIEEVSLADCDPL 120

Query: 121 YQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGY 172
           YQE  +LKLA ELCP L+ D+Q+R+YLK ES+RVL  A++MDG+E+ EDR Y
Sbjct: 121 YQETLSLKLASELCPTLVADEQLRAYLKAESDRVLKTAIEMDGIELSEDREY 172


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122896|ref|YP_004063385.1| hypothetical protein CKC_05760 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 172 Back     alignment and organism information
>gi|317120717|gb|ADV02539.1| hypothetical protein SC2_gp085 [Liberibacter phage SC2] Length = 172 Back     alignment and organism information
>gi|221201504|ref|ZP_03574543.1| conserved hypothetical protein [Burkholderia multivorans CGD2M] Length = 207 Back     alignment and organism information
>gi|221213948|ref|ZP_03586921.1| conserved hypothetical protein [Burkholderia multivorans CGD1] Length = 207 Back     alignment and organism information
>gi|332160973|ref|YP_004297550.1| hypothetical protein YE105_C1351 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 186 Back     alignment and organism information
>gi|296532339|ref|ZP_06895076.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957] Length = 189 Back     alignment and organism information
>gi|187736541|ref|YP_001878653.1| hypothetical protein Amuc_2062 [Akkermansia muciniphila ATCC BAA-835] Length = 206 Back     alignment and organism information
>gi|48697201|ref|YP_024931.1| hypothetical protein BcepC6B_gp11 [Burkholderia phage BcepC6B] Length = 207 Back     alignment and organism information
>gi|242278912|ref|YP_002991041.1| hypothetical protein Desal_1440 [Desulfovibrio salexigens DSM 2638] Length = 197 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target175 hypothetical protein CLIBASIA_05580 [Candidatus Liberib
PHA00662215 PHA00662, PHA00662, hypothetical protein 4e-13
>gnl|CDD|106971 PHA00662, PHA00662, hypothetical protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 175 hypothetical protein CLIBASIA_05580 [Candidatus Liberib
PHA00662215 hypothetical protein 100.0
PHA00428193 tail tubular protein A 99.98
>PHA00662 hypothetical protein Back     alignment and domain information
>PHA00428 tail tubular protein A Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00