254781210

254781210

hypothetical protein CLIBASIA_05585

GeneID in NCBI database:8210235Locus tag:CLIBASIA_05585
Protein GI in NCBI database:254781210Protein Accession:YP_003065623.1
Gene range:-(1212108, 1213139)Protein Length:343aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPGKWHAPQITLTSSFGATRIEPDKILGIEISKDSLKGVPVLKGTKAA
cccHHHHHHHHHHHHHccEEEEEHHHHHHHHHHHHHHccccccEEEEHHcccccHHHHHHccccHHccccccccEEEEEcccccccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccccccccccccccccccccccccccEEEEEEEccccEEEEEEEEEcccEEccccccccccccccccccccEEEEEEcccccEEccccEEEEEEEccccccccEEccccccc
cccHHHHHHHHHHHHHHHHHHHHHccHcccHHHHHHHccccccEEEEEccccEEHcHccccccccEEcccccccEEEEEcccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHcHHHcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHccccccHHHHHHHHHHHcccEEEEHHHHHHcHcccccccccccccccccccccEEEccccccEEEEEEEEEcccEEEEEEEEEccEEEEcccccEcccccccccccccEEEEEEcccccEEccccEEEEEEEEccccccccEEcccccc
MATKEQLATANIYEFKKHVELALQETKsklrptvteqATEGEASALVEvfkpteaheivgdmpdtiynatdqdrrwvghsqfgwaeridpfatldsginpllpyaSLATAAMHRKQDEAILKGMlgvnkkgkigaeteffskenilsavegddFFKTFIGQLITAKSIFrkryidvdseqvYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFinmekvpgndlfpagtkfpglidgkveypngkptvkssakfedtkikyvlpiycKSAVVFTQRKaidvqhskdpgkwhapqitltssfgatriepdkilGIEIskdslkgvpvlkgtkaa
matkeqlataniyefKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLidgkveypngkptvkssakfedtkiKYVLPIYCKSAVVFTQRKAIDvqhskdpgkwhapqitltssfgatriEPDKILGieiskdslkgvpvlkgtkaa
MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPGKWHAPQITLTSSFGATRIEPDKILGIEISKDSLKGVPVLKGTKAA
*****QL*TANIYEFKKHVEL******************EGEASALVEVFKPTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPGKWHAPQITLTSSFGATRIEPDKILGIEISKDSLKGVPVLKG****
MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPGKWHAPQITLTSSFGATRIEPDKILGIEISKDSLKGVPVLKGTKAA
**TKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPGKWHAPQITLTSSFGATRIEPDKILGIEISKDSLKGVPVLKG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPGKWHAPQITLTSSFGATRIEPDKILGIEISKDSLKGVPVLKGTKAA
MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPGKWHAPQITLTSSFGATRIEPDKILGIEISKDSLKGVPVLKGTKAA
MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPGKWHAPQITLTSSFGATRIEPDKILGIEISKDSLKGVPVLKGTKAA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target343 hypothetical protein CLIBASIA_05585 [Candidatus Liberib
317120718306 putative major capsid protein [Liberibacter phage SC2] 1 1e-168
315121935343 hypothetical protein CKC_00925 [Candidatus Liberibacter 1 1e-158
288959385297 hypothetical protein AZL_025440 [Azospirillum sp. B510] 1 6e-14
254251746295 hypothetical protein BDAG_00943 [Burkholderia dolosa AU 1 3e-11
85059166306 hypothetical protein SG1188 [Sodalis glossinidius str. 1 2e-09
85059665306 hypothetical protein SG1687 [Sodalis glossinidius str. 1 6e-09
225158773305 conserved hypothetical protein [Opitutaceae bacterium T 1 1e-08
262043405330 conserved hypothetical protein [Klebsiella pneumoniae s 1 1e-08
295096864303 hypothetical protein ENC_24270 [Enterobacter cloacae su 1 3e-07
332160972302 hypothetical protein YE105_C1350 [Yersinia enterocoliti 1 5e-06
>gi|317120718|gb|ADV02540.1| putative major capsid protein [Liberibacter phage SC2] Length = 306 Back     alignment and organism information
 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 289/290 (99%), Positives = 290/290 (100%)

Query: 1   MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVG 60
           MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVG
Sbjct: 1   MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVG 60

Query: 61  DMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAI 120
           DMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAI
Sbjct: 61  DMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAI 120

Query: 121 LKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQ 180
           LKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQ
Sbjct: 121 LKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQ 180

Query: 181 VYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTK 240
           VYVL+PSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTK
Sbjct: 181 VYVLVPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTK 240

Query: 241 FPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAID 290
           FPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAID
Sbjct: 241 FPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQRKAID 290


Species: Liberibacter phage SC2
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315121935|ref|YP_004062424.1| hypothetical protein CKC_00925 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 343 Back     alignment and organism information
>gi|288959385|ref|YP_003449726.1| hypothetical protein AZL_025440 [Azospirillum sp. B510] Length = 297 Back     alignment and organism information
>gi|254251746|ref|ZP_04945064.1| hypothetical protein BDAG_00943 [Burkholderia dolosa AUO158] Length = 295 Back     alignment and organism information
>gi|85059166|ref|YP_454868.1| hypothetical protein SG1188 [Sodalis glossinidius str. 'morsitans'] Length = 306 Back     alignment and organism information
>gi|85059665|ref|YP_455367.1| hypothetical protein SG1687 [Sodalis glossinidius str. 'morsitans'] Length = 306 Back     alignment and organism information
>gi|225158773|ref|ZP_03725090.1| conserved hypothetical protein [Opitutaceae bacterium TAV2] Length = 305 Back     alignment and organism information
>gi|262043405|ref|ZP_06016530.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 330 Back     alignment and organism information
>gi|295096864|emb|CBK85954.1| hypothetical protein ENC_24270 [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 303 Back     alignment and organism information
>gi|332160972|ref|YP_004297549.1| hypothetical protein YE105_C1350 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 302 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 343 hypothetical protein CLIBASIA_05585 [Candidatus Liberib
PHA00201343 major capsid protein 100.0
PHA02514397 minor capsid protein; Reviewed 100.0
PHA02004330 capsid protein 99.92
pfam05065278 Phage_capsid Phage capsid family. Family of bacteriopha 99.26
pfam11651413 P22_CoatProtein P22 coat protein - gene protein 5. This 99.68
PHA01511430 coat protein 96.76
pfam04454218 Linocin_M18 Encapsulating protein for peroxidase. The L 95.62
>PHA00201 major capsid protein Back     alignment and domain information
>PHA02514 minor capsid protein; Reviewed Back     alignment and domain information
>PHA02004 capsid protein Back     alignment and domain information
>pfam05065 Phage_capsid Phage capsid family Back     alignment and domain information
>pfam11651 P22_CoatProtein P22 coat protein - gene protein 5 Back     alignment and domain information
>PHA01511 coat protein Back     alignment and domain information
>pfam04454 Linocin_M18 Encapsulating protein for peroxidase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target343 hypothetical protein CLIBASIA_05585 [Candidatus Liberib
2xd8_A375 Capsid Structure Of The Infectious Prochlorococcus 7e-39
3izg_G345 Bacteriophage T7 Prohead Shell Em-Derived Atomic Mo 1e-34
gi|298508277|pdb|2XD8|A Chain A, Capsid Structure Of The Infectious Prochlorococcus Cyanophage P-Ssp7 Length = 375 Back     alignment and structure
 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 33/341 (9%), Positives = 77/341 (22%), Gaps = 28/341 (8%)

Query: 9   TANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYN 68
              +  F   +    Q  ++  R  VT++  +   S          +       P     
Sbjct: 28  ALYLKLFSGEMFKGFQ-HETIARDLVTKRTLKNGKSLQFIYTGRMTSSFHTPGTPILGNA 86

Query: 69  A---TDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGML 125
                  ++  V       +  +       +        +     A+  K D  I + + 
Sbjct: 87  DKAPPVAEKTIVMDDLLISSAFVYDLDETLAHYELRGEISKKIGYALAEKYDRLIFRSIT 146

Query: 126 GVNKKGKIGAETEFFSKENILSAVEGDDF------FKTFIGQLITAKSIFRKRYIDVDSE 179
              +     + T F         V               +     A +   ++ +     
Sbjct: 147 RGARSASPVSATNFVEPGGTQIRVGSGTNESDAFTASALVNAFYDAAAAMDEKGVSSQG- 205

Query: 180 QVYVLIPSDVWASLFAL---ERATSKDYINTAALQAGKIEAFAGVWFINMEKVPG----- 231
               ++    + +L          ++D   +A      +   AG+       +P      
Sbjct: 206 -RCAVLNPRQYYALIQDIGSNGLVNRDVQGSALQSGNGVIEIAGIHIYKSMNIPFLGKYG 264

Query: 232 ------NDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFEDTKIKYVLPIYCKSAVVFTQ 285
                       G     +                     +   K    I+ K A    +
Sbjct: 265 VKYGGTTGETSPGNLGSHIGPTPENANATGGVNNDYGTNAELGAKSCGLIFQKEAAGVVE 324

Query: 286 RKAIDVQHS--KDPGKWHAPQITLTSSFGATRIEPDKILGI 324
                VQ +       +    I    + GA  + P   + +
Sbjct: 325 AIGPQVQVTNGDVSVIYQGDVILGRMAMGADYLNPAAAVEL 365


gi|312207821|pdb|3IZG|G Chain G, Bacteriophage T7 Prohead Shell Em-Derived Atomic Model Length = 345 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 hypothetical protein CLIBASIA_05585 [Candidatus Liberib
2xd8_A375 GP10, T7-like capsid protein; marine podovirus, T7-like 100.0
3izg_G345 Major capsid protein 10A; bacteriophage, virus, capsid 100.0
1ohg_A282 Major capsid protein; virus, virus coat protein, virus/ 98.98
3dkt_A265 Maritimacin; enzyme encapsulation, nanocompartment, oxi 97.71
3iyh_A430 Coat protein, protein GP5; HK97-like fold, capsid prote 99.51
2e0z_A345 Virus-like particle; bacteriophage, HK97; 3.60A {Pyroco 97.79
>2xd8_A GP10, T7-like capsid protein; marine podovirus, T7-like virus, virus; 4.60A {Prochlorococcus phage p-ssp7} Back     alignment and structure
Probab=100.00  E-value=0  Score=413.79  Aligned_cols=317  Identities=11%  Similarity=0.013  Sum_probs=252.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEECCCCCCCEEEEECCCCEEEEEECCCCCCCCCCCC---CCCEEEEEECCCCCH
Q ss_conf             79998867789999987112430100230312674068713462355332589874324568---762699982344311
Q gi|254781210|r    9 TANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNAT---DQDRRWVGHSQFGWA   85 (343)
Q Consensus         9 ~aFv~q~~~~v~~a~qqk~s~L~~~V~~~t~~~Gks~~f~~~G~~~A~~~t~r~~~t~~~~~---~~~~~~v~~~~~~~a   85 (343)
                      +.|+|+|+.||+.+||++ ++|+++|++|++.+||+.+||++|+.++.||+++..+++....   ..++++.++++++++
T Consensus        28 alflkifs~EV~~af~~~-sv~~~lv~~r~i~~Gks~~fp~~g~~ta~~~~~g~~i~~~~~~~~~~~e~~itID~~~~~s  106 (375)
T 2xd8_A           28 ALYLKLFSGEMFKGFQHE-TIARDLVTKRTLKNGKSLQFIYTGRMTSSFHTPGTPILGNADKAPPVAEKTIVMDDLLISS  106 (375)
T ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHHEEEEECCCCCEEEEEECCCCCCEEECCCCCCCCCCCCCCCCEEEEEECCCCHHHH
T ss_conf             331787689999999986-5455232676437985797300384122110688744566666565315999737402578


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC------CEEEECCCCCCCCCCH
Q ss_conf             2212688887410068999999999987768899999862014556666654456666------4023023577642228
Q gi|254781210|r   86 ERIDPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKE------NILSAVEGDDFFKTFI  159 (343)
Q Consensus        86 ~~IddiDe~k~~~d~rs~y~~~~g~ALar~~D~~I~~a~~g~a~~~~~g~~~~~~~~~------~~~~~~~~~~~~~lt~  159 (343)
                      ++||||||+|+|+|+|++|++++||||+|++|+.|++.+.+++++.............      ......+..++....+
T Consensus       107 ~~idDide~~sh~d~r~~~t~~aGyALA~~~D~~vl~~l~~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (375)
T 2xd8_A          107 AFVYDLDETLAHYELRGEISKKIGYALAEKYDRLIFRSITRGARSASPVSATNFVEPGGTQIRVGSGTNESDAFTASALV  186 (375)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             87877999874725999999999999999999999999865203567654466544455311344444555555567799


Q ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHHHCCC---CEEEHHCCCCCCCCCCCEEEEEEEEEEEECCCCCCCCCC
Q ss_conf             99999999860238897546079976999998750671---010000013431136701227435899707778766665
Q gi|254781210|r  160 GQLITAKSIFRKRYIDVDSEQVYVLIPSDVWASLFALE---RATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFP  236 (343)
Q Consensus       160 akl~~a~~~ld~~~Vp~~g~~~~~v~~p~~~~~Ll~~t---~~~s~Df~~~~al~~G~I~~~~G~~~i~s~~lp~~~~~~  236 (343)
                      +.|+++++.||++|||++  +||||+||.+|+.||++.   ++.+.|+.+...+.+|.|++++||++|+|||||..+...
T Consensus       187 ~~i~~a~~~LDe~dVP~~--~R~~Vv~P~~y~~Ll~~~~~~~~~~~~~~~~~~~~~g~vg~i~G~~v~~Snn~P~~~~~~  264 (375)
T 2xd8_A          187 NAFYDAAAAMDEKGVSSQ--GRCAVLNPRQYYALIQDIGSNGLVNRDVQGSALQSGNGVIEIAGIHIYKSMNIPFLGKYG  264 (375)
T ss_pred             HHHHHHHHHHHHCCCCCC--CEEEEECHHHHHHHHHCCHHHEEECCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCCCCC
T ss_conf             999999999876499955--618998899999997120021020343346532256651256116899933436644456


Q ss_pred             CCCCCCCCCCCCCCC--------CCCCCCCC---CCCCCCCCCCCEEEEEEECCCCEEEEECCCEEEE---EECCCCCCH
Q ss_conf             444333334565566--------77766666---6665455655137999845410344513531565---541653203
Q gi|254781210|r  237 AGTKFPGLIDGKVEY--------PNGKPTVK---SSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQH---SKDPGKWHA  302 (343)
Q Consensus       237 ~~~~~~~~~~~~~~~--------~~~~~~~~---~~~~~~~~~~~~~~~~~hksAvg~a~~~di~~ei---~~~~~k~~a  302 (343)
                      ...............        ......++   ....+...+++++|++|||+|||+++++|+++|.   +|+++ |++
T Consensus       265 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~s~~~gl~fhk~Avgtv~~~~~~~e~Te~~~~~~-~~~  343 (375)
T 2xd8_A          265 VKYGGTTGETSPGNLGSHIGPTPENANATGGVNNDYGTNAELGAKSCGLIFQKEAAGVVEAIGPQVQVTNGDVSVI-YQG  343 (375)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECHHHHEEEEEECCEEEEEECCCCHH-HHH
T ss_conf             5557655445556555544455333445565335655434456513899975358244445132357630244446-567


Q ss_pred             HEEEHEECCCCEEECCCCEEEEEECHH
Q ss_conf             300010002635654152589995413
Q gi|254781210|r  303 PQITLTSSFGATRIEPDKILGIEISKD  329 (343)
Q Consensus       303 ~~i~~~~s~Ga~~l~~~~vv~I~~~e~  329 (343)
                      ++|+++|+||++.||||++|+|...-+
T Consensus       344 dl~~~~~a~G~~vLRpe~~v~i~~~~~  370 (375)
T 2xd8_A          344 DVILGRMAMGADYLNPAAAVELYIGAT  370 (375)
T ss_pred             HHHHHHHHCCCCCCCCCEEEEEECCCC
T ss_conf             789888764666458440799970688



>3izg_G Major capsid protein 10A; bacteriophage, virus, capsid maturation, cryoelectron micros morphogenetic intermediate, icosahedral; 10.90A {Enterobacteria phage T7} Back     alignment and structure
>1ohg_A Major capsid protein; virus, virus coat protein, virus/viral protein, auto- catalytic cross-LINK, icosahedral virus; 3.45A {Bacteriophage HK97} SCOP: d.183.1.1 PDB: 2frp_A 2fsy_A 2ft1_A 2fte_A 3ddx_A 2gp1_A 2fs3_A 3e8k_A 1if0_A Back     alignment and structure
>3dkt_A Maritimacin; enzyme encapsulation, nanocompartment, oxidative stress, ferritin-like protein, HK97-fold, antibiotic; 3.10A {Thermotoga SP} Back     alignment and structure
>3iyh_A Coat protein, protein GP5; HK97-like fold, capsid protein, late protein, virion, virus; 8.20A {Enterobacteria phage P22} PDB: 3iyi_A Back     alignment and structure
>2e0z_A Virus-like particle; bacteriophage, HK97; 3.60A {Pyrococcus furiosus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 hypothetical protein CLIBASIA_05585 [Candidatus Liberib
d2ft1a1280 Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37 98.89
>d2ft1a1 d.183.1.1 (A:104-383) Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37554]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Major capsid protein gp5
superfamily: Major capsid protein gp5
family: Major capsid protein gp5
domain: Major capsid protein gp5
species: Bacteriophage HK97 [TaxId: 37554]
Probab=98.89  E-value=2.1e-07  Score=58.17  Aligned_cols=245  Identities=11%  Similarity=0.014  Sum_probs=143.2

Q ss_pred             HHHHHCCEECCCCCCCEEEEECCCC--EEEEEECCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2430100230312674068713462--35533258987432456876269998234431122126888874100689999
Q gi|254781210|r   28 SKLRPTVTEQATEGEASALVEVFKP--TEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGINPLLPYA  105 (343)
Q Consensus        28 s~L~~~V~~~t~~~Gks~~f~~~G~--~~A~~~t~r~~~t~~~~~~~~~~~v~~~~~~~a~~IddiDe~k~~~d~rs~y~  105 (343)
                      +.+|++++..+.. +.+..+|+...  ..|....++ +..|..+...+.+.....-+..-..|.+.-. +-..+..+...
T Consensus        29 ~~vr~~~~~~~~~-~~~~~~~~~~~~~~~a~~v~Eg-~~~~~~~~~f~~v~~~~~k~~~~~~iS~ell-~ds~~~~~~v~  105 (280)
T d2ft1a1          29 LTIRDLLAQGRTS-SNALEYVREEVFTNNADVVAEK-ALKPESDITFSKQTANVKTIAHWVQASRQVM-DDAPMLQSYIN  105 (280)
T ss_dssp             CCSGGGSEEEECC-SSEEEEEEEEEEECCCEEECTT-CCCCBCEEEEEEEEEECEEEEEEEEEEHHHH-HHSTTHHHHHH
T ss_pred             HHHHHHHCEEEEC-CCCEEEEEEECCCCCEEEECCC-CCCCCCCCCCCCCCCCCEEEEEEECCCHHHH-HHHHHHHHHHH
T ss_conf             4478660537727-9978988885476866896268-8777565443434344589999953699998-41178999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEC
Q ss_conf             99999987768899999862014556666654456666402302357764222899999999860238897546079976
Q gi|254781210|r  106 SLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDSEQVYVLI  185 (343)
Q Consensus       106 ~~~g~ALar~~D~~I~~a~~g~a~~~~~g~~~~~~~~~~~~~~~~~~~~~~lt~akl~~a~~~ld~~~Vp~~g~~~~~v~  185 (343)
                      +.++.+++++.|+.++.   |.......    ....................+.+.++.+...++.++.+..   .|+ +
T Consensus       106 ~~l~~~~a~~~d~a~l~---G~g~~~~~----~gl~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~---~~~-~  174 (280)
T d2ft1a1         106 NRLMYGLALKEEGQLLN---GDGTGDNL----EGLNKVATAYDTSLNATGDTRADIIAHAIYQVTESEFSAS---GIV-L  174 (280)
T ss_dssp             HHHHHHHHHHHHHHHHS---CCSSTTSC----CCHHHHSEECCGGGCCSSCCHHHHHHHHHHHHHTTSCCCC---EEE-E
T ss_pred             HHHHHHHHHHHHHHHHC---CCCCCCCC----CCCEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC---EEE-E
T ss_conf             99999999986566530---55667776----6521014444322344654321458999987765135575---279-7


Q ss_pred             CHHHHHHHHCCCCEEEHHCCCCCCCCCCCEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99999875067101000001343113670122743589970777876666544433333456556677766666666545
Q gi|254781210|r  186 PSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTVKSSAKFE  265 (343)
Q Consensus       186 ~p~~~~~Ll~~t~~~s~Df~~~~al~~G~I~~~~G~~~i~s~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  265 (343)
                      +|..|..|.....-.. .|.- .....|.-++++|++++.++.+|.....                             -
T Consensus       175 ~~~~~~~l~~lkd~~G-~~l~-~~~~~~~~~~l~G~Pv~~s~~~~~~~~~-----------------------------~  223 (280)
T d2ft1a1         175 NPRDWHNIALLKDNEG-RYIF-GGPQAFTSNIMWGLPVVPTKAQAAGTFT-----------------------------V  223 (280)
T ss_dssp             CHHHHHHHHTCBCTTS-CBSS-STTTCCCCSEETTEEEEECTTSCTTEEE-----------------------------E
T ss_pred             CHHHHHHHHHCCCCCC-CEEC-CCCCCCCCCCCCCEEEEEECCCCCCEEE-----------------------------E
T ss_conf             2768877761116788-6502-5644577750477479972798752489-----------------------------9


Q ss_pred             CCCCCEEEEEEECCCCEEEEECCCEEEEEECCC-C--CCHHEEEHEECCCCEEECCCCEEEEEE
Q ss_conf             565513799984541034451353156554165-3--203300010002635654152589995
Q gi|254781210|r  266 DTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPG-K--WHAPQITLTSSFGATRIEPDKILGIEI  326 (343)
Q Consensus       266 ~~~~~~~~~~~hksAvg~a~~~di~~ei~~~~~-k--~~a~~i~~~~s~Ga~~l~~~~vv~I~~  326 (343)
                      +++         +.+..+....++.+++.+.+. .  +.-..+.+.+-+|....+|+++|....
T Consensus       224 gdf---------~~~~~~~~r~~~~v~~~~~~~~~f~~~~v~~ra~~r~~~~v~~~~Afv~g~~  278 (280)
T d2ft1a1         224 GGF---------DMASQVWDRMDATVEVSREDRDNFVKNMLTILCEERLALAHYRPTAIIKGTF  278 (280)
T ss_dssp             ECH---------HHHEEEEESEEEEEEEESSSTTHHHHTEEEEEEEEEECEEESCGGGEEEEEC
T ss_pred             EEH---------HHEEEEEEECCCEEEEEECCCCHHHCCEEEEEEEEEEEEEEECCCEEEEEEE
T ss_conf             603---------7728999913518998414511644790999999998558807881999996



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 hypothetical protein CLIBASIA_05585 [Candidatus Liberib
1ohg_A_282 Major capsid protein; virus, virus coat protein, v 99.14
2e0z_A_345 Virus-like particle; bacteriophage, HK97; 3.60A {P 97.64
3c5b_A_1-253253 Putative uncharacterized protein; capsid protein, 97.51
>1ohg_A (A:) Major capsid protein; virus, virus coat protein, virus/viral protein, auto- catalytic cross-LINK, icosahedral virus; 3.45A {Bacteriophage HK97} Back     alignment and structure
Probab=99.14  E-value=1.2e-08  Score=67.35  Aligned_cols=252  Identities=9%  Similarity=-0.007  Sum_probs=160.4

Q ss_pred             HHHHHHHHHHHHCCEECCCCCCCEEEEECCC--CEEEEEECCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             9998711243010023031267406871346--23553325898743245687626999823443112212688887410
Q gi|254781210|r   21 LALQETKSKLRPTVTEQATEGEASALVEVFK--PTEAHEIVGDMPDTIYNATDQDRRWVGHSQFGWAERIDPFATLDSGI   98 (343)
Q Consensus        21 ~a~qqk~s~L~~~V~~~t~~~Gks~~f~~~G--~~~A~~~t~r~~~t~~~~~~~~~~~v~~~~~~~a~~IddiDe~k~~~   98 (343)
                      ....+ .+.++..++..++.++ +..+++..  ...+....++ ...+..+...+........+.....| ..+-++...
T Consensus        23 ~~~~~-~~~i~~~~~~~~~~~~-~~~~~~~~~~~~~a~~v~E~-~~~~~~~~~~~~v~~~~~k~~~~~~i-s~ell~~~~   98 (282)
T 1ohg_A           23 MPGLR-RLTIRDLLAQGRTSSN-ALEYVREEVFTNNADVVAEK-ALKPESDITFSKQTANVKTIAHWVQA-SRQVMDDAP   98 (282)
T ss_dssp             CCCCC-CCCSGGGSEEEECCSS-EEEEEEEEEEECCCEEECTT-CCCCBCEEEEEEEEEECEEEEEEEEE-EHHHHHHST
T ss_pred             HHHHC-HHHHHHHCCEEEECCC-CEEEEEEECCCCCEEEECCC-CCCCCCCCCCCCEEEEEEEEEEEECC-CHHHHHHHH
T ss_conf             75403-0457865053763799-67988783576744886158-86765645423135111899999647-989975179


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             06899999999998776889999986201455666665445666640230235776422289999999986023889754
Q gi|254781210|r   99 NPLLPYASLATAAMHRKQDEAILKGMLGVNKKGKIGAETEFFSKENILSAVEGDDFFKTFIGQLITAKSIFRKRYIDVDS  178 (343)
Q Consensus        99 d~rs~y~~~~g~ALar~~D~~I~~a~~g~a~~~~~g~~~~~~~~~~~~~~~~~~~~~~lt~akl~~a~~~ld~~~Vp~~g  178 (343)
                      |+.+...+.++.+++++.|+.++....   .....+    +..................+.+.+..+...+..++.+.. 
T Consensus        99 ~~~~~v~~~l~~~~a~~~d~~~~~g~g---~~~~~~----~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~-  170 (282)
T 1ohg_A           99 MLQSYINNRLMYGLALKEEGQLLNGDG---TGDNLE----GLNKVATAYDTSLNATGDTRADIIAHAIYQVTESEFSAS-  170 (282)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHSCCC---STTSCC----CHHHHCEECCGGGCCTTCCHHHHHHHHHHHTGGGTSCCC-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCC---CCCCCC----CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCC-
T ss_conf             999999999999999997678860667---677755----421111121011123565414679999986764456675-


Q ss_pred             CEEEEECCHHHHHHHHCCCCEEEHHCCCCCCCCCCCEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             60799769999987506710100000134311367012274358997077787666654443333345655667776666
Q gi|254781210|r  179 EQVYVLIPSDVWASLFALERATSKDYINTAALQAGKIEAFAGVWFINMEKVPGNDLFPAGTKFPGLIDGKVEYPNGKPTV  258 (343)
Q Consensus       179 ~~~~~v~~p~~~~~Ll~~t~~~s~Df~~~~al~~G~I~~~~G~~~i~s~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~  258 (343)
                        . ++.+|..|..|.....-..+.  -.....+|..++++|++++.++++|.+..                        
T Consensus       171 --~-~vm~~~~~~~l~~lkd~~g~~--l~~~~~~~~~~~l~G~pV~~~~~~~~~~~------------------------  221 (282)
T 1ohg_A          171 --G-IVLNPRDWHNIALLKDNEGRY--IFGGPQAFTSNIMWGLPVVPTKAQAAGTF------------------------  221 (282)
T ss_dssp             --E-EEECHHHHHHHHTCBCTTSCB--TTTTTTSCCCSEETTEEEEECTTSCTTEE------------------------
T ss_pred             --E-EEEEHHHHHHHHHEECCCCCE--EECCCCCCCCCEECCEEEEECCCCCCCEE------------------------
T ss_conf             --5-998053644565212689966--53134557764035703787178876606------------------------


Q ss_pred             CCCCCCCCCCCCEEEEEEECCCCEEEEECCCEEEEEECCCC---CCHHEEEHEECCCCEEECCCCEEEEEEC
Q ss_conf             66665455655137999845410344513531565541653---2033000100026356541525899954
Q gi|254781210|r  259 KSSAKFEDTKIKYVLPIYCKSAVVFTQRKAIDVQHSKDPGK---WHAPQITLTSSFGATRIEPDKILGIEIS  327 (343)
Q Consensus       259 ~~~~~~~~~~~~~~~~~~hksAvg~a~~~di~~ei~~~~~k---~~a~~i~~~~s~Ga~~l~~~~vv~I~~~  327 (343)
                                    .+.=.++++......++.+++.+.+++   .....+..-+-+|...++|++++.++-.
T Consensus       222 --------------~~gd~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~d~~v~~~~a~~~~~~~  279 (282)
T 1ohg_A          222 --------------TVGGFDMASQVWDRMDATVEVSREDRDNFVKNMLTILCEERLALAHYRPTAIIKGTFS  279 (282)
T ss_dssp             --------------EEECHHHHEEEEESEEEEEEEESSSTTCTTTTEEEEEEEEEECEEESCGGGEEEEECC
T ss_pred             --------------EEEECCCEEEEEEECCCEEEEECCCCHHHHCCEEEEEEEEEEEEEEECCCEEEEEEEE
T ss_conf             --------------8850444179999124089995054106558909999999984377068829999983



>2e0z_A (A:) Virus-like particle; bacteriophage, HK97; 3.60A {Pyrococcus furiosus} Back     alignment and structure
>3c5b_A (A:1-253) Putative uncharacterized protein; capsid protein, HK97 fold, icosahedral virus; 4.50A {Enterobacteria phage EPSILON15} Back     alignment and structure