254781211

254781211

hypothetical protein CLIBASIA_05590

GeneID in NCBI database:8210236Locus tag:CLIBASIA_05590
Protein GI in NCBI database:254781211Protein Accession:YP_003065624.1
Gene range:-(1213152, 1213856)Protein Length:234aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESSTGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ
cccccccccccccccccEEEcccccccccccHHHHHHccccccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHHHccc
ccccccccccccccccEEEEEccccccccccHHHHHccccccccccccccccHcccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHcHHHHHHHHcccccccccEEEccccccccccHcccccccccccccccccHHHHHHHHHHHHHHHHHcc
msdetdqltplpstppvvecersqrsnpppskeeavqsdpqgrnpssssssteeagepkppiedytlscpdyvSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARYFrkekipdndvQSLISAWGFEKTFNFFDRYAqqnkesstgdtfvrsegsqeadrdfdkvfntpdfgsrvlsgdkEATKTLRQWAEKQATLNQ
msdetdqltplpstppvvecersqrsnpppskeeavqsdpqgrnpssssssteeagepkpPIEDYTLSCPDYVSEAEVTAHIEAFkeagvdarVAQKVVDKLVDHGRKigeqfgasleeERKLLqtklgsdyetreKDIARyfrkekipdndVQSLISAWGFEKTFNFFDRYAQQnkesstgdtfvrsegsqeadrdfdkvfntpdfgsrvlsgdkeaTKTLRQWAEKQATLNQ
MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPssssssTEEAGEPKPPIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESSTGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ
*********PLPSTPP************************************************YTLSCPDYVSEAEV*****AFKEAGVDARVAQKVVDKLVD*************EEERKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDR*****************************VFNTPDFGS***************WA********
***********************************************************PPIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQ*******************DRDFDKVFNTPDFGSRVLSGDKEATKTLRQW*********
*******LTPLPSTPPVVECER***********************************PKPPIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNK******************RDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQAT***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESSTGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ
MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESSTGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ
MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESSTGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target234 hypothetical protein CLIBASIA_05590 [Candidatus Liberib
315122898234 hypothetical protein CKC_05770 [Candidatus Liberibacter 1 3e-61
317120719246 hypothetical protein SC2_gp095 [Liberibacter phage SC2] 1 3e-23
31512193660 hypothetical protein CKC_00930 [Candidatus Liberibacter 1 2e-09
77734533 517 hypothetical protein pSG3.03 [Sodalis glossinidius] Len 2 0.004
89886023 517 hypothetical protein SGPHI_0042 [Sodalis phage phiSG1] 2 0.004
>gi|315122898|ref|YP_004063387.1| hypothetical protein CKC_05770 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 234 Back     alignment and organism information
 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 163/230 (70%), Gaps = 6/230 (2%)

Query: 9   TPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLS 68
           TP+ STP   E E  +  N P +KE+ V+S+P  +  S+  +STEEA   +P  EDYTL+
Sbjct: 7   TPV-STPIDTEVESPEVDNTPSTKEQ-VESNPFKKYASTEDTSTEEAEASQPNSEDYTLN 64

Query: 69  CPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHG----RKIGEQFGASLEEERKLL 124
           CP+Y+ + EV AH EAFKEAG+DA+ AQKV+D+LV HG    ++  E+   +L E++  L
Sbjct: 65  CPEYIPQEEVKAHSEAFKEAGIDAKTAQKVIDRLVAHGQENEKRSIERLDKALAEDKTAL 124

Query: 125 QTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESSTGDT 184
           +++ G DY  REKDIARYFR+EKI D DVQ+L+S WGF+KTF FFDRYAQ NKE+S GDT
Sbjct: 125 KSEYGVDYSRREKDIARYFRQEKIADADVQALVSTWGFQKTFKFFDRYAQMNKETSVGDT 184

Query: 185 FVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ 234
           F RSEGS+ +  D+DK+FN P+F  +  +GD  A   ++QWA +QA L+Q
Sbjct: 185 FARSEGSRGSQEDYDKLFNNPEFIEKRKAGDTSANNKIKQWANQQALLDQ 234


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|317120719|gb|ADV02541.1| hypothetical protein SC2_gp095 [Liberibacter phage SC2] Length = 246 Back     alignment and organism information
>gi|315121936|ref|YP_004062425.1| hypothetical protein CKC_00930 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 60 Back     alignment and organism information
>gi|77734533|emb|CAI59394.2| hypothetical protein pSG3.03 [Sodalis glossinidius] Length = 517 Back     alignment and organism information
>gi|89886023|ref|YP_516220.1| hypothetical protein SGPHI_0042 [Sodalis phage phiSG1] Length = 517 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00