254781219

254781219

hypothetical protein CLIBASIA_05630

GeneID in NCBI database:8210244Locus tag:CLIBASIA_05630
Protein GI in NCBI database:254781219Protein Accession:YP_003065632.1
Gene range:+(1220710, 1221312)Protein Length:200aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MEIDLQKQFKNYLHEDVKFYLDKWCEALYSPESYSNTYREQKLRDKIIELRRKFAKENGLKTVTEVCPKPKDITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELLEKVA
cccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHEEEEEEcHHHHHHHHHHc
cccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHcHHHHHHHHHHHHHcHHHccccccEEEHHHcHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHccEEEEEEEcHHHHHHHHHHc
MEIDLQKQFKNYLHEDVKFYLDKWCealyspesysntYREQKLRDKIIELRRKFAKEnglktvtevcpkpkdiTYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNysrdsghlnrdvIFHSRYALIRYLEDFYKEIKhtfgnpadalsphiSELADEIHTTCFTlqfvvnpseAELLEKVA
MEIDLQKQFKNYLHEDVKFYLDKWCEALYspesysntyreqKLRDKIIELRRKfakenglktvtevcpkpkdiTYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKIlkksvrnysrdsghlnrdvifHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELLEKVA
MEIDLQKQFKNYLHEDVKFYLDKWCEALYSPESYSNTYREQKLRDKIIELRRKFAKENGLKTVTEVCPKPKDITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELLEKVA
***D***QFKNYLHEDVKFYLDKWCEALYSP**********KLRDKIIELRRKFAK****KT*TEVCPKPKDITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVR*****SGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELLEK**
MEIDLQKQFKNYLHEDVKFYLDKWCEALYSPESYSNTYREQKLRDKIIELRRKFAKENGLKTVTEVCPKPKDITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELLEKVA
*EIDLQKQFKNYLHEDVKFYLDKWCEALYSPESYSNTYREQKLRDKIIELRRKFAKENGLKTVTEVCPKPKDITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIDLQKQFKNYLHEDVKFYLDKWCEALYSPESYSNTYREQKLRDKIIELRRKFAKENGLKTVTEVCPKPKDITYSLSHFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELLEKVA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target200 hypothetical protein CLIBASIA_05630 [Candidatus Liberib
317120683173 hypothetical protein SC1_gp130 [Liberibacter phage SC1] 1 2e-95
31712072573 hypothetical protein SC2_gp130 [Liberibacter phage SC2] 1 2e-24
31512248989 hypothetical protein CKC_03705 [Candidatus Liberibacter 1 8e-15
>gi|317120683|gb|ADV02506.1| hypothetical protein SC1_gp130 [Liberibacter phage SC1] Length = 173 Back     alignment and organism information
 Score =  352 bits (902), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 173/173 (100%)

Query: 28  LYSPESYSNTYREQKLRDKIIELRRKFAKENGLKTVTEVCPKPKDITYSLSHFIEGLIES 87
           +YSPESYSNTYREQKLRDKIIELRRKFAKENGLKTVTEVCPKPKDITYSLSHFIEGLIES
Sbjct: 1   MYSPESYSNTYREQKLRDKIIELRRKFAKENGLKTVTEVCPKPKDITYSLSHFIEGLIES 60

Query: 88  ERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRY 147
           ERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRY
Sbjct: 61  ERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSRDSGHLNRDVIFHSRYALIRY 120

Query: 148 LEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELLEKVA 200
           LEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELLEKVA
Sbjct: 121 LEDFYKEIKHTFGNPADALSPHISELADEIHTTCFTLQFVVNPSEAELLEKVA 173


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|317120725|gb|ADV02547.1| hypothetical protein SC2_gp130 [Liberibacter phage SC2] Length = 73 Back     alignment and organism information
>gi|315122489|ref|YP_004062978.1| hypothetical protein CKC_03705 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 89 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00