254781220

254781220

hypothetical protein CLIBASIA_05635

GeneID in NCBI database:8210245Locus tag:CLIBASIA_05635
Protein GI in NCBI database:254781220Protein Accession:YP_003065633.1
Gene range:+(1221374, 1221766)Protein Length:130aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQEHKEDYYASQI
ccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEHHcccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccHcHHHHHHccc
MGQLKQYYLEEIEANYEFLSavnprmgiepesnyEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEARedcegcencsehpdqehkedyyasqi
MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKtskklihfrdrtiRTHILEDLIEEVNRIIVLAKAhkrrlelkifednevWRLLDEAREDCEGcencsehpdqehkedyyasqi
MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQEHKEDYYASQI
*******YLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEV*****************************YAS**
MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQEHKEDYYASQI
*GQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEH***EH***YY*S*I
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQEHKEDYYASQI
MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQEHKEDYYASQI
MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQEHKEDYYASQI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target130 hypothetical protein CLIBASIA_05635 [Candidatus Liberib
254780122123 hypothetical protein CLIBASIA_00005 [Candidatus Li 8e-09
254780229 1775 hypothetical protein CLIBASIA_00570 [Candidatus Li 0.039
>gi|254780122|ref|YP_003064535.1| hypothetical protein CLIBASIA_00005 [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Back     alignment
 Score = 50.8 bits (120), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 17/135 (12%)

Query: 1   MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEK---LERALKTSKKLIHFRD 57
           MG LK ++ +EI  N+ F S  N     +P+ + E+++ E    L+  +     ++    
Sbjct: 1   MGALKNHFHDEINENFYFHSHPNA----DPDISIEMQISENQRYLDEEISQCNAVVDVFK 56

Query: 58  RTIRTHILE--DLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSE 115
           R+  T IL+  D ++++   I L +A  + L+  +    E W    E   D E  E   E
Sbjct: 57  RSDST-ILDKLDAMDDLKTYISLLQATAKNLKSLL---KEYW----EESLDGEDDEEIYE 108

Query: 116 HPDQEHKEDYYASQI 130
           HPDQEH+EDYYA+QI
Sbjct: 109 HPDQEHREDYYANQI 123

>gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Back     alignment
 Score = 28.5 bits (62), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query: 33  NYEVEVIEKLERALKTSKKL--IHFR----DRTIRTHILEDLIEEVNRII 76
           NY    IE LERA+K +K L   HF+    D  I+T   +D +E + R+I
Sbjct: 160 NYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLI 209

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target130 hypothetical protein CLIBASIA_05635 [Candidatus Liberib
317120693123 hypothetical protein SC1_gp185 [Liberibacter phage SC1] 1 4e-05
254780122123 hypothetical protein CLIBASIA_00005 [Candidatus Liberib 1 6e-05
315121961128 hypothetical protein CKC_01055 [Candidatus Liberibacter 1 2e-04
>gi|317120693|gb|ADV02516.1| hypothetical protein SC1_gp185 [Liberibacter phage SC1] Length = 123 Back     alignment and organism information
 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 17/135 (12%)

Query: 1   MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEK---LERALKTSKKLIHFRD 57
           MG LK ++ +EI  N+ F S  N     +P+ + E+++ E    L+  +     ++    
Sbjct: 1   MGALKNHFHDEINENFYFHSHPNA----DPDISIEMQISENQRYLDEEISQCNAVVDVFK 56

Query: 58  RTIRTHILE--DLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSE 115
           R+  T IL+  D ++++   I L +A  + L+  +    E W    E   D E  E   E
Sbjct: 57  RSDST-ILDKLDAVDDLKTYISLLQATAKNLKSLL---KEYW----EESLDGEDDEEIYE 108

Query: 116 HPDQEHKEDYYASQI 130
           HPDQEH+EDYYA+QI
Sbjct: 109 HPDQEHREDYYANQI 123


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|254780122|ref|YP_003064535.1| hypothetical protein CLIBASIA_00005 [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Back     alignment and organism information
>gi|315121961|ref|YP_004062450.1| hypothetical protein CKC_01055 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 128 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target130 hypothetical protein CLIBASIA_05635 [Candidatus Liberib
PRK08999312 PRK08999, PRK08999, hypothetical protein; Provisional 0.001
>gnl|CDD|181607 PRK08999, PRK08999, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00