254781221

254781221

hypothetical protein CLIBASIA_05640

GeneID in NCBI database:8210246Locus tag:CLIBASIA_05640
Protein GI in NCBI database:254781221Protein Accession:YP_003065634.1
Gene range:+(1221902, 1222108)Protein Length:68aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------
MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLTKGAKLSSD
cHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
ccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MTIKKVLIASTLLSLcgcgladepkklnpdqLCDAVCRLTLEEQKELQTKVNQRYEEHLtkgaklssd
MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKelqtkvnqryeehltkgaklssd
MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLTKGAKLSSD
***KKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTL********************G******
MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRY*************
MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLTKG******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLTKGAKLSSD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target68 hypothetical protein CLIBASIA_05640 [Candidatus Liberib
25478118071 hypothetical protein CLIBASIA_05435 [Candidatus Li 0.024
>gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Back     alignment
 Score = 28.5 bits (62), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 22/30 (73%)

Query: 22 DEPKKLNPDQLCDAVCRLTLEEQKELQTKV 51
          +EP+K+  DQ+ +A+  L  EE+++LQ ++
Sbjct: 23 EEPQKVTVDQINNAIASLIPEERRDLQDRM 52

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target68 hypothetical protein CLIBASIA_05640 [Candidatus Liberib
31512255871 hypothetical protein CKC_04050 [Candidatus Liberibacter 1 2e-18
31512291271 hypothetical protein CKC_05840 [Candidatus Liberibacter 1 6e-18
31512255774 hypothetical protein CKC_04045 [Candidatus Liberibacter 1 3e-12
>gi|315122558|ref|YP_004063047.1| hypothetical protein CKC_04050 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71 Back     alignment and organism information
 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 58/71 (81%), Gaps = 3/71 (4%)

Query: 1  MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57
          M  K  LIASTL++   L GC LADEPKKLNPDQ+CDA+C LT ++Q+ELQ+KV+++YEE
Sbjct: 1  MKTKTFLIASTLITSGLLAGCDLADEPKKLNPDQICDAICNLTTKQQEELQSKVDKKYEE 60

Query: 58 HLTKGAKLSSD 68
          HL  GAK+SSD
Sbjct: 61 HLKTGAKISSD 71


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122912|ref|YP_004063401.1| hypothetical protein CKC_05840 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71 Back     alignment and organism information
>gi|315122557|ref|YP_004063046.1| hypothetical protein CKC_04045 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 74 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00