254781222

254781222

hypothetical protein CLIBASIA_05645

GeneID in NCBI database:8210247Locus tag:CLIBASIA_05645
Protein GI in NCBI database:254781222Protein Accession:YP_003065635.1
Gene range:+(1222101, 1222313)Protein Length:70aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70
MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGFYRR
ccccHHHHHHHHHHHHHcccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccHHHHHHHHHccccccccccccccccEEEEccHHccHHcHHHHHHHHccccccHcccccccccc
MIKAKEPLEQTIKGLFQqsstdrygriepmtkkykiTKEEHRVFSECHRIRALrgfndvkkgalggfyrr
mikakepleqtikglfqqsstdrygriepmtkkykitkeehrvfsechriralrgfndvkkgalggfyrr
MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGFYRR
*********QTIKGLFQ**************KKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGFYR*
MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGFYRR
****KEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGFYRR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGFYRR
MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGFYRR
MIKAKEPLEQTIKGLFQQSSTDRYGRIEPMTKKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGFYRR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target70 hypothetical protein CLIBASIA_05645 [Candidatus Liberib
163868226 257 hypothetical protein Btr_1055 [Bartonella tribocorum CI 1 4e-04
163868186 257 hypothetical protein Btr_1004 [Bartonella tribocorum CI 1 4e-04
163659869 257 hypothetical protein PlasmidBtr_0010 [Bartonella triboc 1 4e-04
163868264 257 hypothetical protein Btr_1102 [Bartonella tribocorum CI 1 4e-04
163868200 211 hypothetical protein Btr_1020 [Bartonella tribocorum CI 1 6e-04
163867446 197 hypothetical protein Btr_0166 [Bartonella tribocorum CI 1 7e-04
163659871 213 phage related protein [Bartonella tribocorum CIP 105476 1 0.001
163868210 213 hypothetical protein Btr_1034 [Bartonella tribocorum CI 1 0.001
319404492 525 conserved hypothetical protein [Bartonella rochalimae A 1 0.002
49475171127 Phage related protein [Bartonella henselae str. Houston 1 0.004
>gi|163868226|ref|YP_001609434.1| hypothetical protein Btr_1055 [Bartonella tribocorum CIP 105476] Length = 257 Back     alignment and organism information
 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 1/39 (2%)

Query: 30 MTKKYKITKEEHRVFS-ECHRIRALRGFNDVKKGALGGF 67
          ++KKY++T E H       HRIRALR F+DVK GALGGF
Sbjct: 6  VSKKYELTNENHTFEGITVHRIRALRDFDDVKAGALGGF 44


Species: Bartonella tribocorum
Genus: Bartonella
Family: Bartonellaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163868186|ref|YP_001609394.1| hypothetical protein Btr_1004 [Bartonella tribocorum CIP 105476] Length = 257 Back     alignment and organism information
>gi|163659869|ref|YP_001608492.1| hypothetical protein PlasmidBtr_0010 [Bartonella tribocorum CIP 105476] Length = 257 Back     alignment and organism information
>gi|163868264|ref|YP_001609473.1| hypothetical protein Btr_1102 [Bartonella tribocorum CIP 105476] Length = 257 Back     alignment and organism information
>gi|163868200|ref|YP_001609408.1| hypothetical protein Btr_1020 [Bartonella tribocorum CIP 105476] Length = 211 Back     alignment and organism information
>gi|163867446|ref|YP_001608645.1| hypothetical protein Btr_0166 [Bartonella tribocorum CIP 105476] Length = 197 Back     alignment and organism information
>gi|163659871|ref|YP_001608494.1| phage related protein [Bartonella tribocorum CIP 105476] Length = 213 Back     alignment and organism information
>gi|163868210|ref|YP_001609418.1| hypothetical protein Btr_1034 [Bartonella tribocorum CIP 105476] Length = 213 Back     alignment and organism information
>gi|319404492|emb|CBI78099.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 525 Back     alignment and organism information
>gi|49475171|ref|YP_033212.1| Phage related protein [Bartonella henselae str. Houston-1] Length = 127 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target70 hypothetical protein CLIBASIA_05645 [Candidatus Liberib
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 9e-08
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
 Score = 50.6 bits (120), Expect = 9e-08
 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 11/46 (23%)

Query: 32 KKYKITKEEHRVFSEC----------HRIRALRGFNDVKKGALGGF 67
           KY+++ E  R F+             ++ A+  FNDVK G  GG+
Sbjct: 2  TKYRLS-EGPRAFTYQVDGEKKSVLLRQVIAVTDFNDVKAGTSGGW 46


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target70 hypothetical protein CLIBASIA_05645 [Candidatus Liberib
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 97.13
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
Probab=97.13  E-value=1.5e-05  Score=48.64  Aligned_cols=37  Identities=35%  Similarity=0.686  Sum_probs=28.6

Q ss_pred             HHHHHCHHHHHHHH----------HHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             44210489999999----------988888763321433211001101
Q gi|254781222|r   32 KKYKITKEEHRVFS----------ECHRIRALRGFNDVKKGALGGFYR   69 (70)
Q Consensus        32 kkykitkeehrvfs----------echriralrgfndvkkgalggfyr   69 (70)
                      |||.+|.|. |.|+          .-+||||||-|.|||+|.||||-.
T Consensus         2 ~ky~~~~~~-~~~~~~~~~~~~~~~l~~i~a~~~~~~v~~g~~gg~~~   48 (334)
T 2pig_A            2 TKYRLSEGP-RAFTYQVDGEKKSVLLRQVIAVTDFNDVKAGTSGGWVD   48 (334)
T ss_dssp             -CEEECSSC-EEEEEEETTEEEEEEEEEEEESSCBTTBCTTCEEEEES
T ss_pred             CCEEECCCC-CEEEEEECCCCCCCEEEEEEEEECCCCCCCCCCCCEEE
T ss_conf             716823542-02255406762761599999972206422677765558




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 70 hypothetical protein CLIBASIA_05645 [Candidatus Liberib
d2f9ca1 320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonell 1e-07
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure

class: All beta proteins
fold: Single-stranded left-handed beta-helix
superfamily: Trimeric LpxA-like enzymes
family: YdcK-like
domain: Hypothetical protein YdcK
species: Salmonella enterica [TaxId: 28901]
 Score = 49.1 bits (116), Expect = 1e-07
 Identities = 9/37 (24%), Positives = 17/37 (45%)

Query: 31 TKKYKITKEEHRVFSECHRIRALRGFNDVKKGALGGF 67
           + +    +  +      ++ A+  FNDVK G  GG+
Sbjct: 8  PRAFTYQVDGEKKSVLLRQVIAVTDFNDVKAGTSGGW 44


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target70 hypothetical protein CLIBASIA_05645 [Candidatus Liberib
d2f9ca1 320 Hypothetical protein YdcK {Salmonella enterica [TaxId: 96.87
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded left-handed beta-helix
superfamily: Trimeric LpxA-like enzymes
family: YdcK-like
domain: Hypothetical protein YdcK
species: Salmonella enterica [TaxId: 28901]
Probab=96.87  E-value=1.8e-05  Score=46.97  Aligned_cols=24  Identities=38%  Similarity=0.623  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             988888763321433211001101
Q gi|254781222|r   46 ECHRIRALRGFNDVKKGALGGFYR   69 (70)
Q Consensus        46 echriralrgfndvkkgalggfyr   69 (70)
                      --|||||||.|.|||.|.||||-.
T Consensus        23 ~~~~~~a~~~~~~~~~~~~gg~~~   46 (320)
T d2f9ca1          23 LLRQVIAVTDFNDVKAGTSGGWVD   46 (320)
T ss_dssp             EEEEEEECSCCSSSCTTCEEEEES
T ss_pred             EEEEEEEEECCCCCCCCCCCCEEE
T ss_conf             699999862205312688775435



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00