254781223

254781223

intrrupted gp229, phage associated protein

GeneID in NCBI database:8210248Locus tag:CLIBASIA_05650
Protein GI in NCBI database:254781223Protein Accession:YP_003065636.1
Gene range:+(1222345, 1222677)Protein Length:110aa
Gene description:intrrupted gp229, phage associated protein
COG prediction:[M] Acyl-[acyl carrier protein]--UDP-N-acetylglucosamine O-acyltransferase
KEGG prediction:intrrupted GP229, phage associated protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE
cccccEEEEEEEEEEcccccccEEEEEEEEEcccccccccEEEEEcccEEEEEEEcccEEEEcHHEEEHHHHccccEEEEEEEEEEcccEEEEEEEEcccEEEcccEEEc
cccccEEccccEEEcccEEEcccEEEcccEEEccEEEEccEEEEcccEEEEEEEEEccEEEEccEEEEcccEEEccEEEEccEEEEccEEEEEEEEEccccEEccccEcc
MYDNAVVRDCATVIDdarvsgnasVSRFAQVKsnaevsdntyvrdnakvggyakvsgnasvggnaivrdtaevggdAFVIGFTVISgnarvrgnavvggdtvvegdtvle
mydnavvrdcatviddarvsgnasvsrfaqvksnaevsdntyvrdNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVisgnarvrgnavvggdtvvegdtvle
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAvvggdtvvegdtvLE
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVL*
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVL*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE
MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVLE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
255764481 271 UDP-N-acetylglucosamine acyltransferase [Candidatu 0.007
>gi|255764481|ref|YP_003065182.2| UDP-N-acetylglucosamine acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Back     alignment
 Score = 30.8 bits (68), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVS------DNTYVRDNAKVGGYAK 54
           M +N ++   A V + A +  N+ +  F  V S  E+        +  V    K+G + K
Sbjct: 4   MGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTK 63

Query: 55  VSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARV-RGNAVVGGDTVV 103
           V   A +GG+   +    VG +  V    VI     + RG    GG T+V
Sbjct: 64  VFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIV 113

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
317120687134 hypothetical protein SC1_gp150 [Liberibacter phage SC1] 1 2e-48
331090083235 hypothetical protein HMPREF1025_02555 [Lachnospiraceae 1 1e-11
331090083235 hypothetical protein HMPREF1025_02555 [Lachnospiraceae 1 2e-07
331090083 235 hypothetical protein HMPREF1025_02555 [Lachnospiraceae 1 3e-05
229828956274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 3e-11
229828956274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 1e-09
229828956274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 2e-09
229828956 274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 4e-09
229828956 274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 9e-09
229828956 274 hypothetical protein GCWU000342_01041 [Shuttleworthia s 1 6e-08
>gi|317120687|gb|ADV02510.1| hypothetical protein SC1_gp150 [Liberibacter phage SC1] Length = 134 Back     alignment and organism information
 Score =  195 bits (495), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 110/134 (82%), Gaps = 24/134 (17%)

Query: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAK------------ 48
           MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAK            
Sbjct: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNAS 60

Query: 49  ------------VGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAV 96
                       VGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAV
Sbjct: 61  VGGNAIVRDTAEVGGYAKVSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAV 120

Query: 97  VGGDTVVEGDTVLE 110
           VGGDTVVEGDTVLE
Sbjct: 121 VGGDTVVEGDTVLE 134


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|331090083|ref|ZP_08338972.1| hypothetical protein HMPREF1025_02555 [Lachnospiraceae bacterium 3_1_46FAA] Length = 235 Back     alignment and organism information
>gi|331090083|ref|ZP_08338972.1| hypothetical protein HMPREF1025_02555 [Lachnospiraceae bacterium 3_1_46FAA] Length = 235 Back     alignment and organism information
>gi|331090083|ref|ZP_08338972.1| hypothetical protein HMPREF1025_02555 [Lachnospiraceae bacterium 3_1_46FAA] Length = 235 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information
>gi|229828956|ref|ZP_04455025.1| hypothetical protein GCWU000342_01041 [Shuttleworthia satelles DSM 14600] Length = 274 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
COG2171271 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransfe 0.002
COG4801 277 COG4801, COG4801, Predicted acyltransferase [General fu 0.004
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransferase 0.004
COG1044 338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 6e-05
>gnl|CDD|32354 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|34410 COG4801, COG4801, Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 110 intrrupted gp229, phage associated protein [Candidatus
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.86
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.85
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.85
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.84
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.83
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.83
PRK13627196 carnitine operon protein CaiE; Provisional 99.83
TIGR01852 257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 99.83
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.82
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 99.8
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.79
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.77
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.77
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 99.75
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.7
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.69
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.68
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.66
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 99.65
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.63
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.59
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.58
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 99.58
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.54
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.5
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.48
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.47
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.46
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.45
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.43
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.43
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 99.42
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.36
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.35
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.34
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 99.34
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.3
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 99.3
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 99.29
KOG1461 673 consensus 99.28
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 99.28
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.21
KOG1461 673 consensus 99.19
PRK10092183 maltose O-acetyltransferase; Provisional 99.17
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 99.13
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 99.12
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.08
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.05
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.04
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 99.03
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.01
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 98.97
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 98.95
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 98.93
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 98.92
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 98.92
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 98.91
PRK10092183 maltose O-acetyltransferase; Provisional 98.91
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 98.9
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 98.89
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 98.84
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 98.8
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 98.71
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 98.65
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 98.63
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 98.6
KOG1322371 consensus 98.49
KOG3121184 consensus 98.47
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 98.45
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 98.42
KOG1462433 consensus 98.33
KOG4750269 consensus 98.29
PRK11132273 cysE serine acetyltransferase; Provisional 98.22
KOG3121184 consensus 98.05
COG4801 277 Predicted acyltransferase [General function prediction 97.99
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 97.96
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 97.77
COG4801 277 Predicted acyltransferase [General function prediction 97.68
KOG4750269 consensus 97.18
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 96.87
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 96.63
TIGR01853 336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 99.85
PRK00892 343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 99.84
cd03351 254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 99.81
PRK05289 261 UDP-N-acetylglucosamine acyltransferase; Provisional 99.81
PRK12461 256 UDP-N-acetylglucosamine acyltransferase; Provisional 99.81
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 99.81
PRK05289 261 UDP-N-acetylglucosamine acyltransferase; Provisional 99.8
PRK12461 256 UDP-N-acetylglucosamine acyltransferase; Provisional 99.8
PRK00892 343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 99.8
COG1044 338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.78
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.74
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.73
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.69
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 99.66
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 99.65
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.59
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.54
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.25
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.23
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 99.08
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 98.95
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 98.56
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 98.08
KOG1322371 consensus 97.95
KOG4042190 consensus 97.93
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 97.36
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.71
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.69
COG1043 260 LpxA Acyl-[acyl carrier protein] 99.64
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.54
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.05
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 99.0
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 98.89
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 98.85
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 98.72
PRK11132273 cysE serine acetyltransferase; Provisional 98.59
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 98.49
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 98.41
PRK03282406 consensus 98.38
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 98.33
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 98.29
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 98.16
PRK04928405 consensus 98.11
PRK03282406 consensus 98.09
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 98.03
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 98.03
PRK01884435 consensus 98.03
PRK03701431 consensus 97.95
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 97.88
PRK01884435 consensus 97.83
KOG1462433 consensus 97.79
PRK03701431 consensus 97.74
TIGR02353 719 NRPS_term_dom non-ribosomal peptide synthetase terminal 97.6
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 97.54
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 97.44
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 97.38
TIGR02353719 NRPS_term_dom non-ribosomal peptide synthetase terminal 97.34
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 96.81
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 96.57
COG1043 260 LpxA Acyl-[acyl carrier protein] 99.5
PRK13627196 carnitine operon protein CaiE; Provisional 99.32
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.3
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 99.18
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 99.02
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 98.97
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.7
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 98.3
KOG1460407 consensus 98.27
KOG1460407 consensus 98.23
KOG4042190 consensus 97.53
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.08
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>KOG3121 consensus Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>KOG3121 consensus Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
1v3w_A173 Structure Of Ferripyochelin Binding Protein From Py 4e-04
1xhd_A173 X-Ray Crystal Structure Of Putative Acetyltransfera 0.001
gi|39655008|pdb|1V3W|A Chain A, Structure Of Ferripyochelin Binding Protein From Pyrococcus Horikoshii Ot3 Length = 173 Back     alignment and structure
 Score = 48.1 bits (112), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/109 (16%), Positives = 39/109 (35%)

Query: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNAS 60
           ++ +A V + A VI D  +    SV   A ++ + E        +           G  +
Sbjct: 13  IHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHGYPT 72

Query: 61  VGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVL 109
             G  +      +   A V  + +I  ++ +   A +G   ++    V+
Sbjct: 73  EIGEYVTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVV 121


>gi|56554528|pdb|1XHD|A Chain A, X-Ray Crystal Structure Of Putative Acetyltransferase, Product Of Bc4754 Gene [bacillus Cereus] Length = 173 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target110 intrrupted gp229, phage associated protein [Candidatus
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural geno 4e-09
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural geno 2e-07
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 5e-06
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 1e-05
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural geno 3e-05
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysugar; H 0.003
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subunit; 0.001
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structural gen 0.001
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 0.001
1hv9_A456 UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed 0.004
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, cell s 0.004
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural geno 1e-04
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysugar; H 5e-04
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 0.001
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 0.003
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
 Score = 54.9 bits (131), Expect = 4e-09
 Identities = 20/110 (18%), Positives = 43/110 (39%), Gaps = 3/110 (2%)

Query: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKV-GGYAKVSGNA 59
           +          T+   ++V+ +A +     +K +  V  +  VR    +      + G+A
Sbjct: 216 VIAGTEEDAIPTLRYSSQVAEHALIEGNCVLKHHVLVGGHAEVRGGPILLDDRVLIEGHA 275

Query: 60  SVGGNAIVRDTAEVGGDAFVIGFTVISGNARVRGNAVVGGDTVVEGDTVL 109
            + G  ++    E+ G A VI F        +RG  V+ G+  +    ++
Sbjct: 276 CIQGEILIERQVEISGRAAVIAFD--DNTIHLRGPKVINGEDRITRTPLV 323


>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics, joint center for structural genomics, JCSG; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase; 1.80A {Yersinia pestis} PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Length = 276 Back     alignment and structure
>1hv9_A UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed parallel beta-helix, transferase; HET: COA UD1; 2.10A {Escherichia coli} SCOP: b.81.1.4 c.68.1.5 PDB: 2oi5_A* 2oi6_A* 2oi7_A* 3fww_A 1fxj_A* 1fwy_A* Length = 456 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* Length = 456 Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target110 intrrupted gp229, phage associated protein [Candidatus
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-handed pa 99.82
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 99.79
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-handed pa 99.77
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr 99.77
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransfe 99.77
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 99.76
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 99.75
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransfe 99.75
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysugar; H 99.74
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr 99.67
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 99.62
3kwd_A213 Carbon dioxide concentrating mechanism protein; LEFT-ha 99.51
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymidylylt 99.51
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosa 99.8
3kwd_A213 Carbon dioxide concentrating mechanism protein; LEFT-ha 99.8
3cj8_A236 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltra 99.79
3ixc_A191 Hexapeptide transferase family protein; niaid, ssgcid, 99.79
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA binding 99.75
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O 99.75
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; beta 99.72
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; beta 99.72
1xhd_A173 Putative acetyltransferase/acyltransferase; structural 99.71
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed parallel b 99.71
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbonic an 99.68
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structural gen 99.68
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; struct 99.68
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-helix, ac 99.66
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, geobaci 99.64
3ftt_A199 Putative acetyltransferase sacol2570; galactoside O-ace 99.64
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA binding 99.6
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, cell s 99.59
3cj8_A236 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltra 99.57
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel beta- 99.57
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-handed 99.56
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structural gen 99.56
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe 99.55
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosa 99.55
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 99.54
1hv9_A456 UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed 99.53
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta heli 99.51
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 99.5
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed parallel 99.46
3ixc_A191 Hexapeptide transferase family protein; niaid, ssgcid, 99.44
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, cell s 99.41
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; struct 99.41
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed parallel b 99.41
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2- carboxylate N- s 99.4
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB 99.4
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 99.39
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-helix, ac 99.36
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel beta- 99.35
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed parallel 99.33
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbonic an 99.3
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-handed 99.27
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succiny 99.21
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapeptide re 99.16
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB 99.16
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta heli 99.14
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed parallel bet 99.11
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-glucose py 99.04
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-glucose py 98.9
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapeptide re 98.8
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed parallel bet 98.76
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysugar; H 99.73
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymidylylt 99.56
1xhd_A173 Putative acetyltransferase/acyltransferase; structural 99.43
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEFT-han 99.32
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-helix, 99.27
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe 99.27
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT-hande 99.26
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, structur 99.23
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subunit; 99.23
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subunit; 99.19
3dk5_A495 Bifunctional protein GLMU; acetyltransferase, pyrophosp 99.18
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-helix, 98.96
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, structur 98.9
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT-hande 98.9
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2- carboxylate N- s 98.89
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEFT-han 98.82
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT-hand 93.83
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural geno 99.54
3ftt_A199 Putative acetyltransferase sacol2570; galactoside O-ace 99.24
3dk5_A495 Bifunctional protein GLMU; acetyltransferase, pyrophosp 99.51
1hv9_A456 UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed 99.36
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, geobaci 99.32
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
Probab=99.82  E-value=1.5e-20  Score=101.29  Aligned_cols=61  Identities=23%  Similarity=0.395  Sum_probs=42.0

Q ss_pred             CCCCEEECCCEEECCCCEECCCCEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCC
Q ss_conf             9687698897099288399798154575432311222222210011355202211112221
Q gi|254781223|r    1 MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVSDNTYVRDNAKVGGYAKVSGNASV   61 (110)
Q Consensus         1 i~~n~~I~~~a~I~~~~~I~~n~~I~~~~~i~~~~~i~~~~~i~~~~~i~~~~~i~~~~~i   61 (110)
                      |+++++|+|+|.|.++++|++|+.|+|++.|++++.|++++.+..++.++.++.++.++.+
T Consensus         2 I~~~a~IhptAvI~~~a~IG~~V~IGp~~vIg~~v~IG~~~~I~~~v~I~~~~~ig~~~~i   62 (262)
T 2qia_A            2 IDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEI   62 (262)
T ss_dssp             BCTTCEECTTCEECTTCEECTTCEECTTCEECTTEEECTTCEECSSCEECSEEEECSSCEE
T ss_pred             CCCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEECCEEECCCCEECCCCCC
T ss_conf             5898899999899999999998999999999999999999989198899389454135421



>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3cj8_A 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase; APC86892, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.95A {Enterococcus faecalis V583} Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infectious disease; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest center for structural genomics; 1.90A {Bacillus cereus atcc 14579} SCOP: b.81.1.5 PDB: 2eg0_A Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken structural genomics/proteomics initiative; 1.50A {Pyrococcus horikoshii OT3} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics, joint center for structural genomics, JCSG; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} PDB: 3ect_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, structural genomics; 2.15A {Bacillus anthracis} PDB: 3igj_A* Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI, protein structure initiative; 1.74A {Geobacillus kaustophilus HTA426} PDB: 2ic7_A Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* Back     alignment and structure
>3cj8_A 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase; APC86892, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.95A {Enterococcus faecalis V583} Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics, joint center for structural genomics, JCSG; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransferase; acetyltransferase, bifunctional, crystallography, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 1g97_A* 1g95_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>1hv9_A UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed parallel beta-helix, transferase; HET: COA UD1; 2.10A {Escherichia coli} SCOP: b.81.1.4 c.68.1.5 PDB: 2oi5_A* 2oi6_A* 2oi7_A* 3fww_A 1fxj_A* 1fwy_A* Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase; 1.80A {Yersinia pestis} PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infectious disease; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} PDB: 3ect_A* Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2- carboxylate N- succinyltransferase; NP_282733.1, structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, structural genomics; 2.15A {Bacillus anthracis} PDB: 3igj_A* Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken structural genomics/proteomics initiative; 1.50A {Pyrococcus horikoshii OT3} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure