254781224

254781224

hypothetical protein CLIBASIA_05655

GeneID in NCBI database:8210249Locus tag:CLIBASIA_05655
Protein GI in NCBI database:254781224Protein Accession:YP_003065637.1
Gene range:-(1222931, 1223242)Protein Length:103aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MEKTAVRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH
ccHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ccccHHHHHHHHccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MEKTAVRQKVQKDSVEIRFTKLEtalpylatkADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH
mektavrqkvqkdsveirftkletalpylatkaDLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH
MEKTAVRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH
**************VEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH
***********KDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH
*******Q*VQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLS**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKTAVRQKVQKDSVEIRFTKLETALPYLATxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH
MEKTAVRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH
MEKTAVRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILLKLSSH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target103 hypothetical protein CLIBASIA_05655 [Candidatus Liberib
254781198117 guanylate kinase [Candidatus Liberibacter asiaticu 0.013
254780430189 nitrogen fixation protein [Candidatus Liberibacter 0.035
>gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Back     alignment
 Score = 29.6 bits (65), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 20/84 (23%)

Query: 18 RFTKLETALPYLATKAD-----LADVRTELKQDIANVRTELKADIADVRTELACTKSELK 72
          R T LE     L+ K +     L +   + ++DIANVR E    +A+VR E+A  ++E+ 
Sbjct: 31 RITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIE----VANVRIEVANVRTEM- 85

Query: 73 DAINSQTKWFMGIIVSVLVSTIGI 96
                    +G+I  +  + IGI
Sbjct: 86 ----------LGLIWKIPATAIGI 99

>gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Back     alignment
 Score = 28.1 bits (61), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 6   VRQKVQKDSVEIRFTKLETALPYLATKADLADVRTE---LKQDIANVRTELKADIADVRT 62
           VR  V +D  +I F      + +L+ +   +   +    LK  +AN+      ++ D+RT
Sbjct: 129 VRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILNHFVPEVKDIRT 188

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target103 hypothetical protein CLIBASIA_05655 [Candidatus Liberib
317120689125 hypothetical protein SC1_gp160 [Liberibacter phage SC1] 1 3e-47
315122491158 hypothetical protein CKC_03715 [Candidatus Liberibacter 1 9e-28
328953340185 hypothetical protein Desac_1645 [Desulfobacca acetoxida 1 2e-06
328953340185 hypothetical protein Desac_1645 [Desulfobacca acetoxida 1 5e-04
303328055117 putative protein p47 [Desulfovibrio sp. 3_1_syn3] Lengt 1 4e-06
328953337167 hypothetical protein Desac_1642 [Desulfobacca acetoxida 1 4e-05
328953339141 hypothetical protein Desac_1644 [Desulfobacca acetoxida 1 7e-05
24216395159 hypothetical protein LA_3696 [Leptospira interrogans se 1 2e-04
237750684160 predicted protein [Helicobacter bilis ATCC 43879] Lengt 1 3e-04
6606259238 BdrC1 [Borrelia hermsii] Length = 238 1 0.001
>gi|317120689|gb|ADV02512.1| hypothetical protein SC1_gp160 [Liberibacter phage SC1] Length = 125 Back     alignment and organism information
 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 101/125 (80%), Positives = 103/125 (82%), Gaps = 22/125 (17%)

Query: 1   MEKTAVRQKVQKDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELK------ 54
           MEKTAV+QKVQ+DSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELK      
Sbjct: 1   MEKTAVKQKVQRDSVEIRFTKLETALPYLATKADLADVRTELKQDIANVRTELKQDIANV 60

Query: 55  ----------------ADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILL 98
                           ADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILL
Sbjct: 61  RTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVSVLVSTIGILL 120

Query: 99  KLSSH 103
           KLSSH
Sbjct: 121 KLSSH 125


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315122491|ref|YP_004062980.1| hypothetical protein CKC_03715 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Back     alignment and organism information
>gi|328953340|ref|YP_004370674.1| hypothetical protein Desac_1645 [Desulfobacca acetoxidans DSM 11109] Length = 185 Back     alignment and organism information
>gi|328953340|ref|YP_004370674.1| hypothetical protein Desac_1645 [Desulfobacca acetoxidans DSM 11109] Length = 185 Back     alignment and organism information
>gi|303328055|ref|ZP_07358494.1| putative protein p47 [Desulfovibrio sp. 3_1_syn3] Length = 117 Back     alignment and organism information
>gi|328953337|ref|YP_004370671.1| hypothetical protein Desac_1642 [Desulfobacca acetoxidans DSM 11109] Length = 167 Back     alignment and organism information
>gi|328953339|ref|YP_004370673.1| hypothetical protein Desac_1644 [Desulfobacca acetoxidans DSM 11109] Length = 141 Back     alignment and organism information
>gi|24216395|ref|NP_713876.1| hypothetical protein LA_3696 [Leptospira interrogans serovar Lai str. 56601] Length = 159 Back     alignment and organism information
>gi|237750684|ref|ZP_04581164.1| predicted protein [Helicobacter bilis ATCC 43879] Length = 160 Back     alignment and organism information
>gi|6606259|gb|AAF19146.1|AF143476_1 BdrC1 [Borrelia hermsii] Length = 238 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 103 hypothetical protein CLIBASIA_05655 [Candidatus Liberib
pfam01442191 Apolipoprotein Apolipoprotein A1/A4/E domain. These pro 97.53
pfam01442191 Apolipoprotein Apolipoprotein A1/A4/E domain. These pro 97.41
pfam07798177 DUF1640 Protein of unknown function (DUF1640). This fam 97.2
pfam07798177 DUF1640 Protein of unknown function (DUF1640). This fam 96.78
>pfam01442 Apolipoprotein Apolipoprotein A1/A4/E domain Back     alignment and domain information
>pfam01442 Apolipoprotein Apolipoprotein A1/A4/E domain Back     alignment and domain information
>pfam07798 DUF1640 Protein of unknown function (DUF1640) Back     alignment and domain information
>pfam07798 DUF1640 Protein of unknown function (DUF1640) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target103 hypothetical protein CLIBASIA_05655 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 3e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 38.8 bits (89), Expect = 3e-04
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 11/37 (29%)

Query: 2  EKTAVRQKVQKDSVEIRFTKL---ETALPYLATKADL 35
          EK A++ K+Q  S+     KL   ++A P LA KA +
Sbjct: 18 EKQALK-KLQA-SL-----KLYADDSA-PALAIKATM 46


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target103 hypothetical protein CLIBASIA_05655 [Candidatus Liberib
1nfn_A191 Apolipoprotein E3; lipid transport, heparin-binding, pl 96.04
1nfn_A191 Apolipoprotein E3; lipid transport, heparin-binding, pl 96.0
1gs9_A165 Apolipoprotein E, APOE4; lipid transport, heparin-bindi 95.46
1gs9_A165 Apolipoprotein E, APOE4; lipid transport, heparin-bindi 95.0
3lay_A175 Zinc resistance-associated protein; salmonella typhimur 94.34
>1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A Back     alignment and structure
Probab=96.04  E-value=0.016  Score=32.31  Aligned_cols=66  Identities=20%  Similarity=0.178  Sum_probs=32.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999888999999999999999999999999999999999999999999999999999999999999
Q gi|254781224|r   23 ETALPYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGIIVS   88 (103)
Q Consensus        23 e~~~~~l~~k~di~~LR~Elk~~i~~LR~Elk~di~~LR~El~~~~~~LR~ei~~~~~~l~G~~~a   88 (103)
                      ++..++-.++.++..+|..+......|+..+...+..+|..+.....+|+..+....-.|...+.+
T Consensus        96 ~~e~l~~~l~~~~eelr~~l~~~~~el~~~~~~~~eelr~~l~~~~eel~~~l~~~~eel~~~L~~  161 (191)
T 1nfn_A           96 ELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAV  161 (191)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999988779999999999899999988889999999999789999998899



>1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A Back     alignment and structure
>1gs9_A Apolipoprotein E, APOE4; lipid transport, heparin-binding, plasma, lipid binding protein; 1.7A {Homo sapiens} SCOP: a.24.1.1 PDB: 1or3_A 1or2_A 1le4_A 1bz4_A 1lpe_A 1le2_A Back     alignment and structure
>1gs9_A Apolipoprotein E, APOE4; lipid transport, heparin-binding, plasma, lipid binding protein; 1.7A {Homo sapiens} SCOP: a.24.1.1 PDB: 1or3_A 1or2_A 1le4_A 1bz4_A 1lpe_A 1le2_A Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium LT2, ZRAP, periplasm, structural genomics; 2.70A {Salmonella enterica subsp} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target103 hypothetical protein CLIBASIA_05655 [Candidatus Liberib
d1gs9a_144 Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606 95.73
d1gs9a_144 Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606 95.43
>d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Four-helical up-and-down bundle
superfamily: Apolipoprotein
family: Apolipoprotein
domain: Apolipoprotein E
species: Human (Homo sapiens), E4 [TaxId: 9606]
Probab=95.73  E-value=0.026  Score=29.72  Aligned_cols=59  Identities=19%  Similarity=0.217  Sum_probs=25.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88999999999999999999999999999999999999999999999999999999999
Q gi|254781224|r   27 PYLATKADLADVRTELKQDIANVRTELKADIADVRTELACTKSELKDAINSQTKWFMGI   85 (103)
Q Consensus        27 ~~l~~k~di~~LR~Elk~~i~~LR~Elk~di~~LR~El~~~~~~LR~ei~~~~~~l~G~   85 (103)
                      ++-.+..++..||..+..++..+|..+..-+.++|..+...+.++|+.+...+..+..-
T Consensus        68 ~~~~l~~~~e~lr~~l~~~lee~r~kl~~~~eel~~~~~~~~ee~r~~l~p~~eel~~~  126 (144)
T d1gs9a_          68 TRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKR  126 (144)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCCCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99888865999999998789999999998899999999899999999878999999999



>d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00