254781225

254781225

P4 family phage/plasmid primase

GeneID in NCBI database:8210250Locus tag:CLIBASIA_05660
Protein GI in NCBI database:254781225Protein Accession:YP_003065638.1
Gene range:-(1223290, 1225659)Protein Length:789aa
Gene description:P4 family phage/plasmid primase
COG prediction:[R] Predicted ATPase
KEGG prediction:P4 family phage/plasmid primase
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------79
MPVMQWKEQAKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPKGLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIKGLKLKPAFESVDDNSNIIDFKR
cccccccHHHHHHHHcccEEEEEcccccccccccccccccccHHHHHHcccccEEEEcccccccEEEEEEccccHHHHHHHHHHHHHHccccEEEEcccccEEEEEEccccccccccccccccccEEEEEcccEEEccccccccccEEEEcccHHHccccccccccHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccEEEEEccccEEEccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEcccHHcccccccccccccEEEccccccccccHHHEEEEcccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHEEEEEEccccccHHHHHHHHHHHHccccEEEccHHHHHHHccccccccccHHHHHcccEEEEEccccccccccHHHHHEEEcccEEEEEcccccccEEcccEEEEEEEcccccccccccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHccccccEEHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccccccccccEEEEEEEEcccccccccccEEEEcc
cccEEEEcccEEEEEEccccEEcccccccccHHHHHHcccccHHHHHcccccccEEEEEEEEccccccccccccEEEEEcccccccHHccHHHHHcccccccHHHHHccccccccEEEcccccccccccccccEEEEccccccccccEEcccccccccccccccccHHHcccccccccccccccEcccHccccEEEEEEHccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHccccHHcHHHHHHccccHHHccccccEEEccccccccccccHHccHHHHHHHHHHHHcccEEEEcccccEEEEEcccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHccccEEEcHHHcccccccccccccEEEcccccEccccHHHcEEEEEccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHcHHHHHcccHHHHHcccccccccccHHHHHccccEEEEEEccccccEccHHHHHHHcccccEEEEccccccEEEccccEEEEEEEcccccEccccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHccccccccccEEEEEEEEccHHccccccccEEEccc
MPVMQWKEQAKQAIHNGfkliplrlgdkrpqrlgKWEEQLLSsekidklpacgfgfvcgvgeqplyafdidskdektanTFKDTFEIlhgtpivrigqkpkilipfrmnkegikkkkttestqghldilgcgqyfvaynihpktkkeytwttpphrfkvedtpllseeDVEYLFKFFQEItvplvkdkksiipsktwtnnnnrqyTNREITAFLSCFgeefyngshdewIPVVMAVHhetrgsskgKEIARRWskqgstydeenfnykwdtfdfeeigdtakkrstftslfyhhgklipkgllasrFSDAYNKAMFSIYKKGHFLYTADTKawykkdknnvyIWSLTLDKITASIMNFLVSMKedvfdlseepednnknsksprfwfntdyrrqnveenskakstaqsleagsiFSITSDlldsssrflgeqdgildletgqkvkptkelyitkstgtpfvegepsqEFLDLVSGYFESEEVMDYFTRCVGMALlggnkaqrfihirgvggsgkSTLMNLIKYAFgnqyvinaeasdimqnrppeagkanpsLIRLMGSRIVIIsetnendeiNAAKIKQMTGGDCMTARlnygntysespasftpfivpnkhlfvrnpddawwrryivipfdkpianrdASFAQKLETKYTLEAKKWFLKGVKAYIskgldvdipeVCLKAKeeerqgtdtYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLkqkgfiggikREKIEKEWKSKRIIKglklkpafesvddnsniidfkr
MPVMQWKEQAKQAIhngfkliplrlgdkrpqRLGKWEEQLLSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTfeilhgtpivrigqkpkilipfrmnkegikkkkttestqghldILGCGQYFVAYNIHPKTkkeytwttpphrfkvedtplLSEEDVEYLFKFFQeitvplvkdkksiipsktwtnnnnrqytNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHEtrgsskgkeiarrwskqgstydeenfnyKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPKGLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFDLseepednnknsksprfwfntDYRRQNVEenskakstaqsleagsIFSITSDLLDSSSRFLGEQdgildletgqkvkptkelyitkstgtpfvegepsQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKeeerqgtdtyqAWIDDCCDIGENLWEESHSLAKSYSEYREQElnydrkristrtvtlnlkqkgfiggikrekiekewkskriikglklkpafesvddnsniidfkr
MPVMQWKEQAKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPKGLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIKGLKLKPAFESVDDNSNIIDFKR
********QAKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIK******STQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEIT***********************YTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPKGLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIM********KANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGG*********WKSKRIIKGLKLKPAFESVDDN********
**********KQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHH***************SKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPKGLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFD***********SKSPRFWFNTDYRRQNV************LEAGSIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIKGLKLKPAFESVDDNSNIIDFKR
MPVMQWKEQAKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPKGLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIKGLKLKPAFESVDDNSNIIDFKR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVMQWKEQAKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPKGLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIKGLKLKPAFESVDDNSNIIDFKR
MPVMQWKEQAKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPKGLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIKGLKLKPAFESVDDNSNIIDFKR
MPVMQWKEQAKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPKGLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLVSMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSDLLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSESPASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSEYREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIKGLKLKPAFESVDDNSNIIDFKR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target789 P4 family phage/plasmid primase [Candidatus Liberibacte
254781190233 hypothetical protein CLIBASIA_05485 [Candidatus Li 1e-80
>gi|254781190|ref|YP_003065603.1| hypothetical protein CLIBASIA_05485 [Candidatus Liberibacter asiaticus str. psy62] Length = 233 Back     alignment
 Score =  292 bits (748), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 132/233 (56%), Positives = 169/233 (72%)

Query: 41  LSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKP 100
           + +  +D     GFG +CG+G  P+YAFD+D  DE+  + F + F+   G PI R+GQ P
Sbjct: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60

Query: 101 KILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVE 160
           K L+ FRM +  +KK+K+ E  QGHL+ L  GQ FVAYNIHPKT++ YTW+  PH  KVE
Sbjct: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120

Query: 161 DTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEE 220
           + PLL+ ++VEY F+FF  IT P  K+K     SK W ++NNR+YTN EI AFLSCFGEE
Sbjct: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180

Query: 221 FYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFD 273
           FYNGSHDEWIPVVMA+H+ETRGS++GKEI R W K G TYDE++FN KWD+FD
Sbjct: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target789 P4 family phage/plasmid primase [Candidatus Liberibacte
317120690790 phage associated primase [Liberibacter phage SC1] Lengt 1 0.0
317120732790 phage associated primase/P4 family phage/plasmid primas 1 0.0
315121955686 P4 family phage/plasmid primase [Candidatus Liberibacte 1 0.0
315122922333 P4 family phage/plasmid primase [Candidatus Liberibacte 1 1e-156
315122923356 P4 family phage/plasmid primase [Candidatus Liberibacte 1 1e-142
254781190233 hypothetical protein CLIBASIA_05485 [Candidatus Liberib 1 1e-76
315122493120 P4 family phage/plasmid primase [Candidatus Liberibacte 1 3e-53
9633023771 putative DNA-polymerase or DNA-primase [Lactobacillus p 1 4e-35
223044345768 primase [Staphylococcus capitis SK14] Length = 768 1 5e-34
237653460782 P4 family phage/plasmid primase [Thauera sp. MZ1T] Leng 1 5e-32
>gi|317120690|gb|ADV02513.1| phage associated primase [Liberibacter phage SC1] Length = 790 Back     alignment and organism information
 Score = 1588 bits (4111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/790 (96%), Positives = 774/790 (97%), Gaps = 1/790 (0%)

Query: 1   MPVMQWKEQAKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGV 60
           MP MQWKEQAKQAIHNGFKLIPLRL DKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGV
Sbjct: 1   MPGMQWKEQAKQAIHNGFKLIPLRLRDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGV 60

Query: 61  GEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTE 120
           GEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTE
Sbjct: 61  GEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTE 120

Query: 121 STQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEI 180
           STQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEI
Sbjct: 121 STQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEI 180

Query: 181 TVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHET 240
           TVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHET
Sbjct: 181 TVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHET 240

Query: 241 RGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPK 300
           RGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPK
Sbjct: 241 RGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPK 300

Query: 301 GLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLV 360
           GLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLV
Sbjct: 301 GLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLV 360

Query: 361 SMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSD 420
           SMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSD
Sbjct: 361 SMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSD 420

Query: 421 LLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESE 480
           LLDSSSRFLGEQDGILDLETGQK+KPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESE
Sbjct: 421 LLDSSSRFLGEQDGILDLETGQKIKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESE 480

Query: 481 EVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQ 540
           EVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQ
Sbjct: 481 EVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQ 540

Query: 541 NRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSES 600
           NRPPEAGKANPSLIRLMG+R+VIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSES
Sbjct: 541 NRPPEAGKANPSLIRLMGARVVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSES 600

Query: 601 PASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFL 660
           PASFTPFIV NKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFL
Sbjct: 601 PASFTPFIVSNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFL 660

Query: 661 KGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSE 720
           KGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSE
Sbjct: 661 KGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSE 720

Query: 721 YREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIE-KEWKSKRIIKGLKLKPAFESVD 779
           YREQELNYDRKRISTRTV LNLKQKGF  G + EK      +  R+I+GLKLKPAFESVD
Sbjct: 721 YREQELNYDRKRISTRTVALNLKQKGFKAGRQWEKPRPNRGRYLRVIEGLKLKPAFESVD 780

Query: 780 DNSNIIDFKR 789
           DN+NIIDFKR
Sbjct: 781 DNNNIIDFKR 790


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|317120732|gb|ADV02554.1| phage associated primase/P4 family phage/plasmid primase [Liberibacter phage SC2] Length = 790 Back     alignment and organism information
>gi|315121955|ref|YP_004062444.1| P4 family phage/plasmid primase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 686 Back     alignment and organism information
>gi|315122922|ref|YP_004063411.1| P4 family phage/plasmid primase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 333 Back     alignment and organism information
>gi|315122923|ref|YP_004063412.1| P4 family phage/plasmid primase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 356 Back     alignment and organism information
>gi|254781190|ref|YP_003065603.1| hypothetical protein CLIBASIA_05485 [Candidatus Liberibacter asiaticus str. psy62] Length = 233 Back     alignment and organism information
>gi|315122493|ref|YP_004062982.1| P4 family phage/plasmid primase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 120 Back     alignment and organism information
>gi|9633023|ref|NP_050131.1| putative DNA-polymerase or DNA-primase [Lactobacillus phage phiadh] Length = 771 Back     alignment and organism information
>gi|223044345|ref|ZP_03614380.1| primase [Staphylococcus capitis SK14] Length = 768 Back     alignment and organism information
>gi|237653460|ref|YP_002889774.1| P4 family phage/plasmid primase [Thauera sp. MZ1T] Length = 782 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target789 P4 family phage/plasmid primase [Candidatus Liberibacte
TIGR01613304 TIGR01613, primase_Cterm, phage/plasmid primase, P4 fam 2e-35
PRK07078759 PRK07078, PRK07078, hypothetical protein; Validated 6e-33
PRK14709469 PRK14709, PRK14709, hypothetical protein; Provisional 4e-31
pfam09250161 pfam09250, Prim-Pol, Bifunctional DNA primase/polymeras 9e-10
cd04859152 cd04859, Prim_Pol, Prim_Pol: Primase-polymerase (primpo 5e-09
pfam0870774 pfam08707, PriCT_2, Primase C terminal 2 (PriCT-2) 2e-06
COG3378517 COG3378, COG3378, Predicted ATPase [General function pr 7e-30
>gnl|CDD|130674 TIGR01613, primase_Cterm, phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>gnl|CDD|180825 PRK07078, PRK07078, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|173172 PRK14709, PRK14709, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|150055 pfam09250, Prim-Pol, Bifunctional DNA primase/polymerase, N-terminal Back     alignment and domain information
>gnl|CDD|80309 cd04859, Prim_Pol, Prim_Pol: Primase-polymerase (primpol) domain of the type found in bifunctional replicases from archaeal plasmids, including ORF904 protein of the crenarchaeal plasmid pRN1 from Sulfolobus islandicus (pRN1 primpol) Back     alignment and domain information
>gnl|CDD|149686 pfam08707, PriCT_2, Primase C terminal 2 (PriCT-2) Back     alignment and domain information
>gnl|CDD|33185 COG3378, COG3378, Predicted ATPase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 789 P4 family phage/plasmid primase [Candidatus Liberibacte
PRK07078510 hypothetical protein; Validated 100.0
COG3378517 Phage associated DNA primase [General function predicti 100.0
TIGR01613316 primase_Cterm phage/plasmid primase, P4 family, C-termi 100.0
pfam09250161 Prim-Pol Bifunctional DNA primase/polymerase, N-termina 99.87
cd04859152 Prim_Pol Prim_Pol: Primase-polymerase (primpol) domain 99.85
cd00525136 AE_Prim_S_like AE_Prim_S_like: primase domain similar t 98.98
pfam08706145 D5_N D5 N terminal like. This domain is found in D5 pro 99.86
pfam0870774 PriCT_2 Primase C terminal 2 (PriCT-2). This alpha heli 99.19
COG4983495 Uncharacterized conserved protein [Function unknown] 98.97
pfam05272198 VirE Virulence-associated protein E. This family contai 98.91
pfam01057271 Parvo_NS1 Parvovirus non-structural protein NS1. This f 98.21
pfam047351173 Baculo_helicase Baculovirus DNA helicase. 98.15
COG5545517 Predicted P-loop ATPase and inactivated derivatives [Ge 98.13
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 92.58
pfam00519432 PPV_E1_C Papillomavirus helicase. This protein is a DNA 97.98
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 96.99
PRK00440318 rfc replication factor C small subunit; Reviewed 96.52
PRK04195403 replication factor C large subunit; Provisional 96.12
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 93.6
PRK10865857 protein disaggregation chaperone; Provisional 93.36
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 93.27
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.13
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 92.67
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 91.68
pfam00493327 MCM MCM2/3/5 family. 91.1
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 90.97
CHL00176 631 ftsH cell division protein; Validated 90.7
pfam0328888 Pox_D5 Poxvirus D5 protein-like. This family includes D 97.53
pfam0225773 RFX_DNA_binding RFX DNA-binding domain. RFX is a regula 96.34
PRK03992390 proteasome-activating nucleotidase; Provisional 97.5
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 95.65
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 94.08
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 97.22
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.68
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 95.94
COG2884223 FtsE Predicted ATPase involved in cell division [Cell d 93.92
PRK12402337 replication factor C small subunit 2; Reviewed 93.74
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 93.57
pfam05621302 TniB Bacterial TniB protein. This family consists of se 92.63
PRK07429331 phosphoribulokinase; Provisional 92.54
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 92.44
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 92.3
PRK05480209 uridine kinase; Provisional 92.3
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 92.14
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 92.07
PRK13851343 type IV secretion system protein VirB11; Provisional 91.93
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 91.74
PRK04220306 2-phosphoglycerate kinase; Provisional 91.69
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 91.57
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 91.36
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 91.32
PRK10744257 phosphate transporter subunit; Provisional 91.26
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 91.26
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 91.26
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 91.18
PRK11545177 gntK gluconate kinase 1; Provisional 91.15
PRK10646153 putative ATPase; Provisional 91.15
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 91.12
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 90.45
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 90.39
pfam00503350 G-alpha G-protein alpha subunit. G proteins couple rece 90.36
COG0802149 Predicted ATPase or kinase [General function prediction 90.35
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 90.29
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 90.15
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 90.13
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 90.08
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 90.07
KOG3712736 consensus 97.2
KOG0743457 consensus 96.27
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 96.17
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 93.48
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 91.84
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 90.47
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.11
pfam00004131 AAA ATPase family associated with various cellular acti 96.05
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 95.86
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 95.78
pfam07726131 AAA_3 ATPase family associated with various cellular ac 92.82
PRK08118167 topology modulation protein; Reviewed 92.53
KOG0651388 consensus 91.54
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 91.2
PRK13407334 bchI magnesium chelatase subunit I; Provisional 90.15
PRK13531498 regulatory ATPase RavA; Provisional 95.74
PRK13341726 recombination factor protein RarA/unknown domain fusion 95.32
pfam06431417 Polyoma_lg_T_C Polyomavirus large T antigen C-terminus. 94.6
PRK13900332 type IV secretion system ATPase VirB11; Provisional 94.55
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 94.41
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 93.84
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 93.83
KOG1970634 consensus 92.97
TIGR00602670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 92.28
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 92.84
PRK07261171 topology modulation protein; Provisional 92.78
cd03239178 ABC_SMC_head The structural maintenance of chromosomes 92.7
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 92.58
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 91.85
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 91.41
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 91.04
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 90.77
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 90.55
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 90.12
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 90.05
COG3839338 MalK ABC-type sugar transport systems, ATPase component 92.72
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 91.5
PRK08939306 primosomal protein DnaI; Reviewed 91.72
pfam05049375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 91.34
pfam08800136 VirE_N VirE N-terminal domain. This presumed domain is 90.39
PRK10535648 macrolide transporter ATP-binding /permease protein; Pr 90.22
>PRK07078 hypothetical protein; Validated Back     alignment and domain information
>COG3378 Phage associated DNA primase [General function prediction only] Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain; InterPro: IPR006500 These sequences form a clade within a larger family of proteins from viruses of bacteria and animals Back     alignment and domain information
>pfam09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal Back     alignment and domain information
>cd04859 Prim_Pol Prim_Pol: Primase-polymerase (primpol) domain of the type found in bifunctional replicases from archaeal plasmids, including ORF904 protein of the crenarchaeal plasmid pRN1 from Sulfolobus islandicus (pRN1 primpol) Back     alignment and domain information
>cd00525 AE_Prim_S_like AE_Prim_S_like: primase domain similar to that found in the small subunit of archaeal and eukaryotic (A/E) DNA primases Back     alignment and domain information
>pfam08706 D5_N D5 N terminal like Back     alignment and domain information
>pfam08707 PriCT_2 Primase C terminal 2 (PriCT-2) Back     alignment and domain information
>COG4983 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam05272 VirE Virulence-associated protein E Back     alignment and domain information
>pfam01057 Parvo_NS1 Parvovirus non-structural protein NS1 Back     alignment and domain information
>pfam04735 Baculo_helicase Baculovirus DNA helicase Back     alignment and domain information
>COG5545 Predicted P-loop ATPase and inactivated derivatives [General function prediction only] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K; InterPro: IPR014232 Proteins in this entry include the stage V sporulation protein K (SpoVK), a close homologue of the Rubisco expression protein CbbX (IPR000470 from INTERPRO), and are members of an ATPase family associated with various cellular activities Back     alignment and domain information
>pfam00519 PPV_E1_C Papillomavirus helicase Back     alignment and domain information
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI Back     alignment and domain information
>pfam00493 MCM MCM2/3/5 family Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>pfam03288 Pox_D5 Poxvirus D5 protein-like Back     alignment and domain information
>pfam02257 RFX_DNA_binding RFX DNA-binding domain Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937 Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>pfam08298 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein; InterPro: IPR013505 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>pfam05621 TniB Bacterial TniB protein Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>pfam00437 GSPII_E Type II/IV secretion system protein Back     alignment and domain information
>PRK05480 uridine kinase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670 This is a family of phosphate transport system permease proteins Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK10744 phosphate transporter subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein; InterPro: IPR005666 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK10646 putative ATPase; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ATPase; InterPro: IPR010132 Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>pfam00503 G-alpha G-protein alpha subunit Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>KOG3712 consensus Back     alignment and domain information
>KOG0743 consensus Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE; InterPro: IPR005286 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>pfam00004 AAA ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>pfam07728 AAA_5 AAA domain (dynein-related subfamily) Back     alignment and domain information
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG0651 consensus Back     alignment and domain information
>pfam00910 RNA_helicase RNA helicase Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>pfam06431 Polyoma_lg_T_C Polyomavirus large T antigen C-terminus Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR014155 This entry contains VirB11, a protein that is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family; InterPro: IPR014324 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1970 consensus Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24; InterPro: IPR004582 To be effective as a mechanism that preserves genomic integrity, the DNA damage checkpoint must be extremely sensitive in its ability to detect DNA damage Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein; InterPro: IPR011924 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein; InterPro: IPR012693 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulphate Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein; InterPro: IPR005968 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>pfam00485 PRK Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit; InterPro: IPR005892 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>pfam05049 IIGP Interferon-inducible GTPase (IIGP) Back     alignment and domain information
>pfam08800 VirE_N VirE N-terminal domain Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target789 P4 family phage/plasmid primase [Candidatus Liberibacte
1rni_A216 Bifunctional Dna PrimasePOLYMERASE DOMAIN OF ORF904 2e-15
1ro0_A216 Bifunctional Dna PrimasePOLYMERASE DOMAIN OF ORF904 1e-13
3m1m_A335 Crystal Structure Of The Primase-Polymerase From Su 2e-15
>gi|42543570|pdb|1RNI|A Chain A, Bifunctional Dna PrimasePOLYMERASE DOMAIN OF ORF904 FROM The Archaeal Plasmid Prn1 Length = 216 Back     alignment and structure
 Score = 89.6 bits (220), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 69/207 (33%), Gaps = 26/207 (12%)

Query: 8   EQAKQAIHNGFKLIPLRLGDKRP--QRLGKWEEQLLSSEKIDKLPA-----CGFGFVCGV 60
             AK  + +GF +IP+    K+P  +   K+  ++ S E+  +          +    G 
Sbjct: 6   RYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQ 65

Query: 61  GEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIP--------FRMNKEG 112
             + L   D +SK++  A   +   E L    +        I I          ++N   
Sbjct: 66  --KGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLF 123

Query: 113 IKKKKTTESTQGHLD-ILGCGQYFVAYNIH----PKTKKEYTWTTPPHRFKVEDTPLLSE 167
            +  K     Q +   +LG G      +      P  ++ YT     +     +   +S+
Sbjct: 124 EENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLY----NELKEISK 179

Query: 168 EDVEYLFKFFQEITVPLVKDKKSIIPS 194
            D++ L +F  E    L          
Sbjct: 180 VDLKSLLRFLAEKGKRLGITLSKTAKE 206


>gi|42543571|pdb|1RO0|A Chain A, Bifunctional Dna PrimasePOLYMERASE DOMAIN OF ORF904 FROM The Archaeal Plasmid Prn1- Triple Mutant F50mL107ML110M Semet Remote Length = 216 Back     alignment and structure
>gi|298508556|pdb|3M1M|A Chain A, Crystal Structure Of The Primase-Polymerase From Sulfolobus Islandicus Length = 335 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target789 P4 family phage/plasmid primase [Candidatus Liberibacte
1ro2_A216 Hypothetical protein ORF904; DNA polymerase, primase, r 4e-10
3m1m_A335 ORF904; primase, polymerase, plasmid, replication; 1.85 0.002
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpases, 5e-09
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA repli 8e-06
1tue_A212 Replication protein E1; helicase, replication, E1E2 com 0.004
>1ro2_A Hypothetical protein ORF904; DNA polymerase, primase, replication, polymerization, evolution of nucleic acid polymerizing enzymes; 1.60A {Sulfolobus islandicus} SCOP: d.264.1.2 PDB: 1ro0_A 1rni_A Length = 216 Back     alignment and structure
 Score = 62.4 bits (151), Expect = 4e-10
 Identities = 34/191 (17%), Positives = 66/191 (34%), Gaps = 24/191 (12%)

Query: 8   EQAKQAIHNGFKLIPLRLGDKRP--QRLGKWEEQLLSSEKIDKL-----PACGFGFVCGV 60
             AK  + +GF +IP+    K+P  +   K+  ++ S E+  +          +      
Sbjct: 6   RYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPG-- 63

Query: 61  GEQPLYAFDIDSKDEKTA-NTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKK-- 117
           G++ +   D +SK++  A        E+   T          I I    N     K    
Sbjct: 64  GQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGG-IHIYVLSNDIPPHKINPL 122

Query: 118 TTESTQGHLDILGCGQYFVA------YNIHPKTKKEYTW---TTPPHRFKVEDTPLLSEE 168
             E+ +G +D+     Y +       +      K  +     TT        +   +S+ 
Sbjct: 123 FEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCY--TLYNELKEISKV 180

Query: 169 DVEYLFKFFQE 179
           D++ L +F  E
Sbjct: 181 DLKSLLRFLAE 191


>3m1m_A ORF904; primase, polymerase, plasmid, replication; 1.85A {Sulfolobus islandicus} Length = 335 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Length = 267 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding, early protein; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Length = 305 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Length = 212 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target789 P4 family phage/plasmid primase [Candidatus Liberibacte
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpases, 99.94
3m1m_A335 ORF904; primase, polymerase, plasmid, replication; 1.85 99.9
1ro2_A216 Hypothetical protein ORF904; DNA polymerase, primase, r 99.89
1tue_A212 Replication protein E1; helicase, replication, E1E2 com 99.69
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA repli 99.59
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: ATP; 1. 97.43
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA ATPa 97.03
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-class A 96.9
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleoti 96.8
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; prob 96.69
1njg_A250 DNA polymerase III subunit gamma; rossman-like fold, AA 96.58
2zan_A444 Vacuolar protein sorting-associating protein 4B; SKD1, 96.58
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nucleoti 96.22
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, struct 96.16
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, ATP-bi 95.54
2chg_A226 Replication factor C small subunit; DNA-binding protein 95.39
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSLU; ch 94.73
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processivity 94.35
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processivity 93.57
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, complex 93.3
1jr3_A373 DNA polymerase III subunit gamma; processivity, process 92.88
2chq_A319 Replication factor C small subunit; DNA-binding protein 92.01
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processivity 90.76
1dp7_P76 MHC class II transcription factor HRFX1; winged helix, 98.42
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P97/VCP 96.38
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural genom 95.26
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrolase; 95.21
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.8 94.81
2r62_A268 Cell division protease FTSH homolog; ATPase domain, ATP 94.49
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fold, hy 94.29
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamerizati 93.86
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fold, hy 93.64
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, transpo 93.38
3bos_A242 Putative DNA replication factor; YP_927791.1, putative 91.56
2x8a_A274 Nuclear valosin-containing protein-like; nuclear protei 91.44
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, trans 90.43
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA prote 96.18
1w5s_A412 ORC2; CDC6, DNA replication initiation, DNA binding pro 91.23
2p5t_B253 PEZT; postsegregational killing system, phosphoryltrans 95.95
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1.95A 95.63
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processivity 95.36
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processivity 95.17
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase; 2.0 94.37
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase, NAD 94.11
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural genomi 93.99
2r44_A331 Uncharacterized protein; putative ATPase, structural ge 93.98
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 int 93.97
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transferase; 2 93.11
3c8u_A208 Fructokinase; YP_612366.1, putative fructose transport 93.04
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sheet w 92.74
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); kina 92.61
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, rossmann, 92.37
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, structur 92.34
2bdt_A189 BH3686; alpha-beta protein, structural genomics, PSI, p 92.23
1htw_A158 HI0065; nucleotide-binding fold, structural genomics, s 92.11
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 92.08
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleotide-bi 91.93
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP-bindi 91.77
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-bindin 91.72
2rhm_A193 Putative kinase; ZP_00765535.1, structural genomics, jo 91.68
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfate syn 91.49
2oap_1511 GSPE-2, type II secretion system protein; hexameric ATP 91.34
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P-loop, 91.29
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., stru 91.01
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleotide bi 90.53
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: AMP A 90.43
1kag_A173 SKI, shikimate kinase I; transferase, structural genomi 90.4
2qby_B384 CDC6 homolog 3, cell division control protein 6 homolog 90.24
3kta_A182 Chromosome segregation protein SMC; structural maintena 90.13
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATPase d 95.9
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; HET: 93.9
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, crystal, b 90.92
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like protein 93.7
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; PH d 92.07
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding protei 91.1
1cip_A353 Protein (guanine nucleotide-binding protein alpha-1 sub 91.02
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YORR; al 90.18
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, MUKE, 93.05
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-binding, 92.02
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombination 91.26
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
Probab=99.94  E-value=6.1e-29  Score=208.49  Aligned_cols=216  Identities=9%  Similarity=0.026  Sum_probs=166.4

Q ss_pred             ECCCEEECCCCCCCCCCHHHHCCEECCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEEECC
Q ss_conf             07937974388855898655010013788887579478999998887999999999999999975987433799997078
Q gi|254781225|r  431 EQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESEEVMDYFTRCVGMALLGGNKAQRFIHIRGVG  510 (789)
Q Consensus       431 ~~NGv~dl~t~~~~~~~~~~~~t~~~~~~y~~~a~~p~~~~~l~~~~~d~e~~~~l~~~~g~~l~g~~~~~~~~~~~G~G  510 (789)
                      ++|++.+.+...++.+.+.+|++...+....   ..+.+.+||.- .+- + ..++..++...|.+.+..+.+++++|+|
T Consensus        40 vk~~~~~~~~~~~~~~~~~~~i~~~~~~~d~---~~~~i~~~l~~-q~~-~-~~~~~~~l~~~l~~~~~k~n~~~l~Gp~  113 (267)
T 1u0j_A           40 IKAALDNAGKIMSLTKTAPDYLVGQQPVEDI---SSNRIYKILEL-NGY-D-PQYAASVFLGWATKKFGKRNTIWLFGPA  113 (267)
T ss_dssp             HHHHHHHHHHHHHHHCCHHHHHSCSSCCSCG---GGCHHHHHHHH-TTC-C-HHHHHHHHHHHHTTCSTTCCEEEEECST
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHCCCCCCCC---CHHHHHHHHHH-CCC-C-HHHHHHHHHHHHCCCCCCCEEEEEECCC
T ss_conf             9999999999998746999995535866777---61799999987-598-8-8999999999973799762699998899


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCHHHHHHCCCEEEEEECCCCCCCCCCCEEEEEECCCEEEEE
Q ss_conf             86257899999997233000344267642012455556898899738980999934677760131002454159858732
Q gi|254781225|r  511 GSGKSTLMNLIKYAFGNQYVINAEASDIMQNRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTAR  590 (789)
Q Consensus       511 ~nGKSt~~~~l~~llG~~~~~~~~~~~~~~~~~~~~~~~~~~la~l~g~r~~~~~E~~~~~~~~~~~~K~ltggD~i~ar  590 (789)
                      +||||+|+++|..++|.+++...             .+.++.++.|.|+|+++.+|+..... ..+.+|+|+|||+|.++
T Consensus       114 ~tGKS~f~~~i~~~~g~~~~~~~-------------~~s~F~l~~l~~~~~~~~~e~~~~~~-~~~~~K~l~gGd~v~vd  179 (267)
T 1u0j_A          114 TTGKTNIAEAIAHTVPFYGCVNW-------------TNENFPFNDCVDKMVIWWEEGKMTAK-VVESAKAILGGSKVRVD  179 (267)
T ss_dssp             TSSHHHHHHHHHHHSSCEEECCT-------------TCSSCTTGGGSSCSEEEECSCCEETT-THHHHHHHHTTCCEEC-
T ss_pred             CCCHHHHHHHHHHHHCCCEEECC-------------CCCCCCCCCCCCCEEEEEECCCCCHH-HHHHHHHHCCCCCEEEE
T ss_conf             88789999999998273145247-------------78887666667987999958986222-89999987489936875


Q ss_pred             ECCCCCCEEEECCEEEEEECCCCCCCCCC-------CCCEEEEEEEEECCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             10478606871452899973886342679-------84166468999658878887878334220120447999999999
Q gi|254781225|r  591 LNYGNTYSESPASFTPFIVPNKHLFVRNP-------DDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFLKGV  663 (789)
Q Consensus       591 ~~~~~~~~~~~p~~~~~~~~N~~P~~~~~-------d~~~~rR~~iipF~~~~~~~d~~~~~~~~~~e~~~i~~w~l~g~  663 (789)
                      .||++++ +++|+.++++++|++|.+.+.       +.|++||+++++|+++||....    .+...|..++++|+.+++
T Consensus       180 ~K~k~~~-~~~~~p~li~snndi~~~~~~~~~s~~~~~~l~~R~~~~~F~~~~p~~~~----~i~~~e~~~f~~W~~~~~  254 (267)
T 1u0j_A          180 QKCKSSA-QIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFG----KVTKQEVKDFFRWAKDHV  254 (267)
T ss_dssp             -----CC-EECCCCEEEEESSCTTCEEETTEEECTTHHHHHTTEEEEECCSCCCTTSC----CCCHHHHHHHHHHHHHTC
T ss_pred             ECCCCCE-EEECCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHEEEEECCCCCCCCCC----CCCHHHHHHHHHHHHHCC
T ss_conf             1468873-84176089994897765568775531020454650799878982797668----768899999999998366


Q ss_pred             HHHHHCCC
Q ss_conf             99998788
Q gi|254781225|r  664 KAYISKGL  671 (789)
Q Consensus       664 ~~~~~~g~  671 (789)
                      .++.++..
T Consensus       255 ~~~~~~~~  262 (267)
T 1u0j_A          255 VEVEHEFY  262 (267)
T ss_dssp             CCCCCCSB
T ss_pred             HHHHHHHC
T ss_conf             14467640



>3m1m_A ORF904; primase, polymerase, plasmid, replication; 1.85A {Sulfolobus islandicus} Back     alignment and structure
>1ro2_A Hypothetical protein ORF904; DNA polymerase, primase, replication, polymerization, evolution of nucleic acid polymerizing enzymes; 1.60A {Sulfolobus islandicus} SCOP: d.264.1.2 PDB: 1ro0_A 1rni_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding, early protein; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, membrane, nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, alternative splicing, ATP-binding, hydrolase, magnesium; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, cytoplasm, nucleotide- binding, hydrolase; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1dp7_P MHC class II transcription factor HRFX1; winged helix, protein- DNA conovel mode of DNA recognition, transcription/DNA complex; HET: DNA BRU; 1.50A {Synthetic} SCOP: a.4.5.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, acetylation, ATP-binding, cytoplasm, lipid-binding, nucleotide-binding; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell cycle, hydrolase, membrane metal-binding, metalloprotease; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: ATG; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Back     alignment and structure
>3bos_A Putative DNA replication factor; YP_927791.1, putative DNA replication regulator HDA, structural genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis SB2B} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A ORC2; CDC6, DNA replication initiation, DNA binding protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, helix-turn-helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, structural genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleotide binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure