255764516

255764516

hypothetical protein CLIBASIA_05532

GeneID in NCBI database:8303226Locus tag:CLIBASIA_05532
Protein GI in NCBI database:255764516Protein Accession:YP_003084344.1
Gene range:-(1197003, 1198028)Protein Length:341aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDESSLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQTEDVGRKLEQIDLSKVEGLDPQTRKYLQDIQTQLTSDTLTLQLDDTRVDDTRGYDSSIRFKDKDGALGGSITRVVKGDITGLSIATKNKSGSLENRIKFYDDKDVYINGQCFVKGTDTSIFDEIARQLTPRFLGLLQGRTMVRSANLREKASIGDIITGDKIAYWAYPSENSSGYISASATQEHTMAVSAENARKRWRIMGKTDSYYITLYWLQEVINFDD
cccccccccccEEEEEEEEEEEEEEEEcccccEEEEEEcccccHHHccccccEEEEEcccEEEEEccEEEccccEEEEEEccccccccccHHHHEHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHccccEEEEEEcccEEccccccccEEEEEccccccccEEEEEEEcccEEEEEEEcccccccccEEEEEcccEEEEEEEEEEEccccHHHHHHHHHHcHHHHHHHcccEEEEcccccccccccccccccEEEEEEEccccccEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEHHHHHHHHcccc
cccEccccccccEEEEcccEEEEEEEccccccEEEEEEccccccHHcccccccEEEcccccHEEccHHHEcccccEHHEcccccccccccEEEEHHHcHHHHHcccccccccHHcHHHEEccccccccHEEEccccccccHHHHHHHHHHHHHHccccEEEEccccccccccccccEEEEEcccccccccEEEEEEcccccEEEEEcccccccccEEEEEccccEEEccEEEEcccccHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHcccccHcccccEEEEEccccccccEEEEcccHHcHHEEEHHHHHHHHHHHcccccHHHHHHHHHHHHcccc
mmqynfeqskdvsyrLFGSyfvipwtvkdpsrihaevkypdgnmeelsperdfkvdvdessliLSSKRWINNNNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQTEDVGRkleqidlskvegldpqtRKYLQDIQTQLTSDtltlqlddtrvddtrgydssirfkdkdgalggsitRVVKGDITGLSiatknksgslenrikfyddkdvyingqcfvkgtdtsiFDEIARQLTPRFLGLLQGRTMVRSANLrekasigdiitgdkiaywaypsenssgyisasaTQEHTMAVSAENARKRWRIMGKTDSYYITLYWLQEVINFDD
MMQYNFEQSKDVSYRLFGSYFVipwtvkdpsrIHAEVkypdgnmeelsperdfkvDVDESSlilsskrwinnnNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQTEDVGRKLEQidlskvegldpqTRKYLQDIQtqltsdtltlqlddtrvddtrgydssirfkdkdgalggsitrvvkgditglsiatknksgslenRIKFYDDKDVYINGQCFVKGTDTSIFDEIARQLTPRFLGLLQGRTMVrsanlrekasigdiitgDKIAYWAYPSENSSGYISASATQEHTMAVSAENARKRWRIMGKTDSYYITLYWLQEVINFDD
MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDESSLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQTEDVGRKLEQIDLSKVEGLDPQTRKYlqdiqtqltsdtltlqlddtrvddtRGYDSSIRFKDKDGALGGSITRVVKGDITGLSIATKNKSGSLENRIKFYDDKDVYINGQCFVKGTDTSIFDEIARQLTPRFLGLLQGRTMVRSANLREKASIGDIITGDKIAYWAYPSENSSGYISASATQEHTMAVSAENARKRWRIMGKTDSYYITLYWLQEVINFDD
********SKDVSYRLFGSYFVIPWTVKDPSRIHA***********LSPERDFKVDVDESSLILSSKRWINNNNALRIFEGEKQTFKDF********NQVNVLTQKMNTIDGIVNDLAIQTEDVGRKLEQIDL***EGLDPQTRKYLQDIQTQLTSDTLTLQLDDTRVDDTRGYDSSIRFKDKDGALGGSITRVVKGDITGL**************IKFYDDKDVYINGQCFVKGTDTSIFDEIARQLTPRFLGLLQGRTMVRSANLREKASIGDIITGDKIAYWAYPSENSS*YI***AT***TM****ENARKRWRIMGKTDSYYITLYWLQEVINF**
MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDESSLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQTEDVGRKLEQIDLSKVEGLDPQTRKYLQDIQTQLTSDTLTLQLDDTRVDDTRGYDSSIRFKDKDGALGGSITRVVKGDITGLSIATKNKSGSLENRIKFYDDKDVYINGQCFVKGTDTSIFDEIARQLTPRFLGLLQGRTMVRSANLREKASIGDIITGDKIAYWAYPSENSSGYISASATQEHTMAVSAENARKRWRIMGKTDSYYITLYWLQEVINFDD
*****F*QSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDESSLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQTEDVGRKLEQIDLSKVEGLDPQTRKYLQDIQTQLTSDTLTLQLDDTRVDDTRGYDSSIRFKDKDGALGGSITRVVKGDITGLSIATKNKSGSLENRIKFYDDKDVYINGQCFVKGTDTSIFDEIARQLTPRFLGLLQGRTMVRSANLREKASIGDIITGDKIAYWAYPSENSSGYISASATQEHTMAVSAENARKRWRIMGKTDSYYITLYWLQEVINFDD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDESSLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQTEDVGRKLEQIDLSKVEGLDPQTRKYLQDIQTQLTSDTLTLQLDDTRVDDTRGYDSSIRFKDKDGALGGSITRVVKGDITGLSIATKNKSGSLENRIKFYDDKDVYINGQCFVKGTDTSIFDEIARQLTPRFLGLLQGRTMVRSANLREKASIGDIITGDKIAYWAYPSENSSGYISASATQEHTMAVSAENARKRWRIMGKTDSYYITLYWLQEVINFDD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target341 hypothetical protein CLIBASIA_05532 [Candidatus Liberib
255764517135 hypothetical protein CLIBASIA_05538 [Candidatus Li 7e-22
>gi|255764517|ref|YP_003084345.1| hypothetical protein CLIBASIA_05538 [Candidatus Liberibacter asiaticus str. psy62] Length = 135 Back     alignment
 Score = 96.3 bits (238), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 10/123 (8%)

Query: 1   MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDES 60
           M + NFEQ+K V+Y   GS FVIPW +KDPSRIHAEV Y DG ++EL+  +DF VD   +
Sbjct: 7   MEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNA 66

Query: 61  SLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQK------KVNQVNVLTQKMNTIDGIV 114
            L ++++      + +RIFEGEKQTFK++N +  +      K   +  L  +++ ++ IV
Sbjct: 67  LLTVNNRE----GDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIV 122

Query: 115 NDL 117
           +DL
Sbjct: 123 SDL 125

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target341 hypothetical protein CLIBASIA_05532 [Candidatus Liberib
317120708280 hypothetical protein SC2_gp020 [Liberibacter phage SC2] 1 1e-157
317120666112 hypothetical protein SC1_gp015 [Liberibacter phage SC1] 1 2e-53
317120667707 hypothetical protein SC1_gp025 [Liberibacter phage SC1] 1 1e-44
317120667 707 hypothetical protein SC1_gp025 [Liberibacter phage SC1] 1 2e-29
317120667 707 hypothetical protein SC1_gp025 [Liberibacter phage SC1] 1 7e-09
317120667707 hypothetical protein SC1_gp025 [Liberibacter phage SC1] 1 7e-09
317120667 707 hypothetical protein SC1_gp025 [Liberibacter phage SC1] 1 8e-09
317120667 707 hypothetical protein SC1_gp025 [Liberibacter phage SC1] 1 8e-09
317120667707 hypothetical protein SC1_gp025 [Liberibacter phage SC1] 1 8e-09
317120667707 hypothetical protein SC1_gp025 [Liberibacter phage SC1] 1 8e-09
>gi|317120708|gb|ADV02530.1| hypothetical protein SC2_gp020 [Liberibacter phage SC2] Length = 280 Back     alignment and organism information
 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 275/275 (100%), Positives = 275/275 (100%)

Query: 1   MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDES 60
           MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDES
Sbjct: 1   MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDES 60

Query: 61  SLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQ 120
           SLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQ
Sbjct: 61  SLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQKKVNQVNVLTQKMNTIDGIVNDLAIQ 120

Query: 121 TEDVGRKLEQIDLSKVEGLDPQTRKYLQDIQTQLTSDTLTLQLDDTRVDDTRGYDSSIRF 180
           TEDVGRKLEQIDLSKVEGLDPQTRKYLQDIQTQLTSDTLTLQLDDTRVDDTRGYDSSIRF
Sbjct: 121 TEDVGRKLEQIDLSKVEGLDPQTRKYLQDIQTQLTSDTLTLQLDDTRVDDTRGYDSSIRF 180

Query: 181 KDKDGALGGSITRVVKGDITGLSIATKNKSGSLENRIKFYDDKDVYINGQCFVKGTDTSI 240
           KDKDGALGGSITRVVKGDITGLSIATKNKSGSLENRIKFYDDKDVYINGQCFVKGTDTSI
Sbjct: 181 KDKDGALGGSITRVVKGDITGLSIATKNKSGSLENRIKFYDDKDVYINGQCFVKGTDTSI 240

Query: 241 FDEIARQLTPRFLGLLQGRTMVRSANLREKASIGD 275
           FDEIARQLTPRFLGLLQGRTMVRSANLREKASIGD
Sbjct: 241 FDEIARQLTPRFLGLLQGRTMVRSANLREKASIGD 275


Species: Liberibacter phage SC2
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|317120666|gb|ADV02489.1| hypothetical protein SC1_gp015 [Liberibacter phage SC1] Length = 112 Back     alignment and organism information
>gi|317120667|gb|ADV02490.1| hypothetical protein SC1_gp025 [Liberibacter phage SC1] Length = 707 Back     alignment and organism information
>gi|317120667|gb|ADV02490.1| hypothetical protein SC1_gp025 [Liberibacter phage SC1] Length = 707 Back     alignment and organism information
>gi|317120667|gb|ADV02490.1| hypothetical protein SC1_gp025 [Liberibacter phage SC1] Length = 707 Back     alignment and organism information
>gi|317120667|gb|ADV02490.1| hypothetical protein SC1_gp025 [Liberibacter phage SC1] Length = 707 Back     alignment and organism information
>gi|317120667|gb|ADV02490.1| hypothetical protein SC1_gp025 [Liberibacter phage SC1] Length = 707 Back     alignment and organism information
>gi|317120667|gb|ADV02490.1| hypothetical protein SC1_gp025 [Liberibacter phage SC1] Length = 707 Back     alignment and organism information
>gi|317120667|gb|ADV02490.1| hypothetical protein SC1_gp025 [Liberibacter phage SC1] Length = 707 Back     alignment and organism information
>gi|317120667|gb|ADV02490.1| hypothetical protein SC1_gp025 [Liberibacter phage SC1] Length = 707 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00