peg_1142

peg_1142

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(1198025, 1198681)Protein Length:218aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
VQEHARGSVGSTIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGAFNHFVRNSIDDVLNPGGRARAEVYRQRQKYKKQRKRNG
cccccccccccccccccccccccccHHHHHHHHHHHHHEEcccccEEHHHccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccccEEccccccccEEEEcccHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc
cccHcccccccccccccEEEcccccHHHHHHHHHHHEEcccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHcHHHHcccccEccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcc
vqehargsvgstiqdkrwitgkdgsvNNLARLMGQFLVMpiswsrmhlieipsslvgvsSQVYRAKALVIGILGEELIRKtlvplisgkepqldfsdpTEYIKALINGIThyerfspfnssgwdvlgpwssqaGKLAIAGkeavwdegtrkqRGKAQAQFGKELVNTFVPFQNLWYARGAFNHFvrnsiddvlnpggraRAEVYRQRQKYKKQRKRNG
vqehargsvgstiqdkrwitgkdGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYRAKALVIGILGEELIRKTLVPLISGkepqldfsdpTEYIKALINGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGAFNHFVRNSIddvlnpggraraevyrqrqkykkqrkrng
VQEHARGSVGSTIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGAFNHFVRNSIDDVLNPGGRARAEVyrqrqkykkqrkrNG
**********STIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLI************VYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAGKEAVWD*********AQAQFGKELVNTFVPFQNLWYARGAFNHFVRNSIDDVLNPGG*********************
************IQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAGKEAVW************AQFGKELVNTFVPFQNLWYARGAFNHFVRNSIDDVLNPGGRARAE****************
************IQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGAFNHFVRNSIDDVLNPGGRARAEVYRQRQKYKKQR****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VQEHARGSVGSTIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGAFNHFVRNSIDDVLNPGGRARAEVYRQRQKYKKQRKRNG
VQEHARGSVGSTIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGAFNHFVRNSIDDVLNPGGRARAEVYRQRQKYKKQRKRNG
VQEHARGSVGSTIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGAFNHFVRNSIDDVLNPGGRARAEVYRQRQKYKKQRKRNG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target218
254781202864 hypothetical protein CLIBASIA_05545 [Candidatus Li 3e-08
>gi|254781202|ref|YP_003065615.1| hypothetical protein CLIBASIA_05545 [Candidatus Liberibacter asiaticus str. psy62] Length = 864 Back     alignment
 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 101/235 (42%), Gaps = 42/235 (17%)

Query: 1   VQEHARGSVGSTIQDKR---WITGKDGS-VNNLARLMGQFLVMPISWSRMHLIEIPSSLV 56
           VQ   RG++ +++ D++    +T K G+      R+  QF   P     ++++++ +S  
Sbjct: 629 VQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMF-LNILDLSNSAK 687

Query: 57  ---GVSSQV------YRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALIN 107
              G S  +      Y A   + GI G   I+     L+ G++P L       Y   L N
Sbjct: 688 MPKGASMALNHVWIQYSATMALAGI-GVASIK----ALLRGEDPSLP---EVIYDGTLAN 739

Query: 108 G--ITHYERFSPFNSSG-----WDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQF 160
           G  + + +R +   S G       +LGP  S    L  +  E    +    +    +A  
Sbjct: 740 GALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNENSKVNATKA-- 797

Query: 161 GKELVNTFVPFQNLWYARGAFNHFVRNSIDDVLNPGGRARAEVYRQRQKYKKQRK 215
               +   +PF N+WY + +F+H + N I + LNPG       Y  RQ+ KK++K
Sbjct: 798 ----IRKTLPFMNMWYLKNSFDHLILNQILEELNPG-------YLDRQQSKKKKK 841

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target218
317120709809 hypothetical protein SC2_gp030 [Liberibacter phage SC2] 1 1e-126
315121926810 hypothetical protein CKC_00880 [Candidatus Liberibacter 1 1e-16
315121758107 hypothetical protein CKC_00040 [Candidatus Liberibacter 1 2e-14
31512230856 hypothetical protein CKC_02800 [Candidatus Liberibacter 1 2e-11
315122771137 hypothetical protein CKC_05130 [Candidatus Liberibacter 1 1e-07
301028422918 conserved hypothetical protein [Escherichia coli MS 196 1 1e-04
291334971530 hypothetical protein [uncultured phage MedDCM-OCT-S08-C 1 1e-04
30387396918 hypothetical protein epsilon15p17 [Enterobacteria phage 1 2e-04
254781202864 hypothetical protein CLIBASIA_05545 [Candidatus Liberib 1 2e-04
330007168924 hypothetical protein HMPREF9538_03599 [Klebsiella sp. M 2 1e-25
>gi|317120709|gb|ADV02531.1| hypothetical protein SC2_gp030 [Liberibacter phage SC2] Length = 809 Back     alignment and organism information
 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/218 (100%), Positives = 218/218 (100%)

Query: 1   VQEHARGSVGSTIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSS 60
           VQEHARGSVGSTIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSS
Sbjct: 592 VQEHARGSVGSTIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSS 651

Query: 61  QVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNS 120
           QVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNS
Sbjct: 652 QVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPFNS 711

Query: 121 SGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGA 180
           SGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGA
Sbjct: 712 SGWDVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGA 771

Query: 181 FNHFVRNSIDDVLNPGGRARAEVYRQRQKYKKQRKRNG 218
           FNHFVRNSIDDVLNPGGRARAEVYRQRQKYKKQRKRNG
Sbjct: 772 FNHFVRNSIDDVLNPGGRARAEVYRQRQKYKKQRKRNG 809


Species: Liberibacter phage SC2
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315121926|ref|YP_004062415.1| hypothetical protein CKC_00880 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 810 Back     alignment and organism information
>gi|315121758|ref|YP_004062247.1| hypothetical protein CKC_00040 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 107 Back     alignment and organism information
>gi|315122308|ref|YP_004062797.1| hypothetical protein CKC_02800 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 56 Back     alignment and organism information
>gi|315122771|ref|YP_004063260.1| hypothetical protein CKC_05130 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 137 Back     alignment and organism information
>gi|301028422|ref|ZP_07191668.1| conserved hypothetical protein [Escherichia coli MS 196-1] Length = 918 Back     alignment and organism information
>gi|291334971|gb|ADD94604.1| hypothetical protein [uncultured phage MedDCM-OCT-S08-C233] Length = 530 Back     alignment and organism information
>gi|30387396|ref|NP_848225.1| hypothetical protein epsilon15p17 [Enterobacteria phage epsilon15] Length = 918 Back     alignment and organism information
>gi|254781202|ref|YP_003065615.1| hypothetical protein CLIBASIA_05545 [Candidatus Liberibacter asiaticus str. psy62] Length = 864 Back     alignment and organism information
>gi|330007168|ref|ZP_08305910.1| hypothetical protein HMPREF9538_03599 [Klebsiella sp. MS 92-3] Length = 924 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target218
PHA01972828 PHA01972, PHA01972, structural protein 1e-06
>gnl|CDD|177329 PHA01972, PHA01972, structural protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 218
PHA01972828 structural protein 100.0
PHA020061337 virion protein 94.62
>PHA01972 structural protein Back     alignment and domain information
>PHA02006 virion protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00