peg_1079

peg_1079

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(1142902, 1143657)Protein Length:251aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:PROBABLE DNA PACKAGING PROTEIN GP2
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF
cccHHHHHHccccccEEEEEEccccccHHHHHHHccccccccEEEEEEEcHHHHHHHHHHHHcccccccEEEEEEEcccccccHHHHHHHHHccccHHHHHHHcccccccccEEEEEcccEEEEccccccHHHEEEcccccccccccEEEEEEEcccccEEEEEEHHHcccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccc
cccccccHHHHccccEcEEEEcccccccEEEEEEEEEcccccEEEEEEccccccHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHcccHHHHHHHHcccccccccEEEccccEEEEEccccccccEEEEcccccccccccEEEEEEccccccEEEHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccEEEc
lkayeqgrdkwqSNTVHyvwfdeeppedvyfegLTRINATQGLvtltltplkgrspiiehylsasssdRQVIRMTInetphyneqerkriidsyplhereartkgepilgsgrifpiveedivinsldipehwvqiggmdfgwhhpfaaghlvwnrdsdviyvvknyrcreqtpIFHVAALKSwgkwlpwawphdglqhdkrsGEQLSAQYRRQGmkmlpecatfddgsngveAGISDMLDRMRSGRWKVF
lkayeqgrdkwqsntvhyVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHylsasssdrqVIRMTInetphyneqerkriidsyplhereartkgepilgsgriFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPecatfddgsngVEAGISdmldrmrsgrwkvf
LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF
*********KWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGL************QYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF
*********KWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF
***YEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF
LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF
LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target251
315122536455 DNA packaging protein Gp2 [Candidatus Liberibacter sola 1 1e-132
150397042477 hypothetical protein Smed_1839 [Sinorhizobium medicae W 1 1e-105
227821702416 DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] 1 1e-104
15965769477 DNA packaging protein GP2 [Sinorhizobium meliloti 1021] 1 1e-104
307315429477 protein of unknown function DUF264 [Sinorhizobium melil 1 1e-104
307318836477 protein of unknown function DUF264 [Sinorhizobium melil 1 1e-104
227822449454 DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] 1 1e-103
71274675472 Protein of unknown function DUF264 [Xylella fastidiosa 1 4e-92
71897556471 Protein of unknown function DUF264 [Xylella fastidiosa 1 7e-92
273810450470 TerL [Xylella phage Xfas53] Length = 470 1 7e-92
>gi|315122536|ref|YP_004063025.1| DNA packaging protein Gp2 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 455 Back     alignment and organism information
 Score =  473 bits (1217), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/251 (87%), Positives = 233/251 (92%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LKAYEQGR+KWQSNTV YVWFDEEPPEDVYFEGLTRINATQGLV LTLTPLKGRS I+EH
Sbjct: 147 LKAYEQGREKWQSNTVDYVWFDEEPPEDVYFEGLTRINATQGLVALTLTPLKGRSNIVEH 206

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           YLS+SS DRQVIRMT+ ETPHY  +ER RII+SYPLHEREARTKGEP+LGSGRIFPI+E+
Sbjct: 207 YLSSSSPDRQVIRMTLEETPHYTAKERIRIINSYPLHEREARTKGEPVLGSGRIFPILEQ 266

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           DIVI S DIPEHW QIGGMDFGWHHPFAA  L WNRDSDVIYVVKNYRCREQTP+FH A 
Sbjct: 267 DIVITSFDIPEHWSQIGGMDFGWHHPFAAVQLAWNRDSDVIYVVKNYRCREQTPLFHAAV 326

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LKSWGKWLPWAWPHDGLQHDK SGEQL+ QYR+QGMKMLPECATFDDGSNGVEAG+SD+L
Sbjct: 327 LKSWGKWLPWAWPHDGLQHDKGSGEQLAVQYRQQGMKMLPECATFDDGSNGVEAGVSDIL 386

Query: 241 DRMRSGRWKVF 251
           DRMRSGRWKVF
Sbjct: 387 DRMRSGRWKVF 397


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397042|ref|YP_001327509.1| hypothetical protein Smed_1839 [Sinorhizobium medicae WSM419] Length = 477 Back     alignment and organism information
>gi|227821702|ref|YP_002825672.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] Length = 416 Back     alignment and organism information
>gi|15965769|ref|NP_386122.1| DNA packaging protein GP2 [Sinorhizobium meliloti 1021] Length = 477 Back     alignment and organism information
>gi|307315429|ref|ZP_07594994.1| protein of unknown function DUF264 [Sinorhizobium meliloti BL225C] Length = 477 Back     alignment and organism information
>gi|307318836|ref|ZP_07598268.1| protein of unknown function DUF264 [Sinorhizobium meliloti AK83] Length = 477 Back     alignment and organism information
>gi|227822449|ref|YP_002826421.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] Length = 454 Back     alignment and organism information
>gi|71274675|ref|ZP_00650963.1| Protein of unknown function DUF264 [Xylella fastidiosa Dixon] Length = 472 Back     alignment and organism information
>gi|71897556|ref|ZP_00679801.1| Protein of unknown function DUF264 [Xylella fastidiosa Ann-1] Length = 471 Back     alignment and organism information
>gi|273810450|ref|YP_003344921.1| TerL [Xylella phage Xfas53] Length = 470 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target251
COG556579 COG5565, COG5565, Bacteriophage terminase large (ATPase 3e-21
pfam03237380 pfam03237, Terminase_6, Terminase-like family 5e-27
>gnl|CDD|35124 COG5565, COG5565, Bacteriophage terminase large (ATPase) subunit and inactivated derivatives [General function prediction only] Back     alignment and domain information
>gnl|CDD|146059 pfam03237, Terminase_6, Terminase-like family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 251
pfam04466387 Terminase_3 Phage terminase large subunit. Initiation o 100.0
pfam03237380 Terminase_6 Terminase-like family. This family represen 100.0
COG1783414 XtmB Phage terminase large subunit [General function pr 99.89
TIGR01547462 phage_term_2 phage terminase, large subunit, PBSX famil 99.67
COG5323410 Uncharacterized conserved protein [Function unknown] 98.94
pfam03354473 Terminase_1 Phage Terminase. The majority of the member 98.05
COG4626546 Phage terminase-like protein, large subunit [General fu 97.0
COG556579 Bacteriophage terminase large (ATPase) subunit and inac 99.08
COG4373509 Mu-like prophage FluMu protein gp28 [General function p 94.71
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 94.24
>pfam04466 Terminase_3 Phage terminase large subunit Back     alignment and domain information
>pfam03237 Terminase_6 Terminase-like family Back     alignment and domain information
>COG1783 XtmB Phage terminase large subunit [General function prediction only] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family; InterPro: IPR006437 This group of sequences represent a highly divergent family of the large subunit of phage terminase Back     alignment and domain information
>COG5323 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam03354 Terminase_1 Phage Terminase Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>COG5565 Bacteriophage terminase large (ATPase) subunit and inactivated derivatives [General function prediction only] Back     alignment and domain information
>COG4373 Mu-like prophage FluMu protein gp28 [General function prediction only] Back     alignment and domain information
>pfam02562 PhoH PhoH-like protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target251
2wbn_A212 Crystal Structure Of The G2p (Large Terminase) Nucl 8e-06
>gi|225733941|pdb|2WBN|A Chain A, Crystal Structure Of The G2p (Large Terminase) Nuclease Domain From The Bacteriophage Spp1 Length = 212 Back     alignment and structure
 Score = 55.2 bits (131), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 20/136 (14%), Positives = 43/136 (31%), Gaps = 12/136 (8%)

Query: 110 GSGRIFPIV--EEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKN 166
           GSG +       E+ +I   ++        G+DFG+   P A     +++  + IY +  
Sbjct: 24  GSGVVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAIDE 83

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
               + +       ++         +    +  D      + A     G+          
Sbjct: 84  LVDHKVSLKRTADFVRKNK------YESARIIADSSEPRSIDALKLEHGIN---RIEGAK 134

Query: 227 DGSNGVEAGISDMLDR 242
            G + VE G   + + 
Sbjct: 135 KGPDSVEHGERWLDEL 150


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target251
2wbn_A212 G2P, terminase large subunit; large terminase, nuclease 1e-09
>2wbn_A G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_A Length = 212 Back     alignment and structure
 Score = 58.6 bits (141), Expect = 1e-09
 Identities = 20/139 (14%), Positives = 43/139 (30%), Gaps = 12/139 (8%)

Query: 109 LGSGRIF--PIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVK 165
           LGSG +    +  E+ +I   ++        G+DFG+   P A     +++  + IY + 
Sbjct: 23  LGSGVVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAID 82

Query: 166 NYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATF 225
                + +       ++                        + A     G+  +      
Sbjct: 83  ELVDHKVSLKRTADFVRKNKYESARIIADSS------EPRSIDALKLEHGINRIEGA--- 133

Query: 226 DDGSNGVEAGISDMLDRMR 244
             G + VE G   + +   
Sbjct: 134 KKGPDSVEHGERWLDELDA 152


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target251
2wbn_A212 G2P, terminase large subunit; large terminase, nuclease 99.79
3c6a_A232 Terminase large subunit; terminase nuclease, viral prot 94.09
3cpe_A592 Terminase, DNA packaging protein GP17; large terminase, 99.63
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide-bindi 98.91
>2wbn_A G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_A Back     alignment and structure
Probab=99.79  E-value=1.7e-19  Score=123.44  Aligned_cols=130  Identities=17%  Similarity=0.235  Sum_probs=100.0

Q ss_pred             CCCCE-EECCCEEE-CCC-CEEECCCCCCCCCCEEEEEECCCCC-CCCEEEEEEEECCCCEEEEEEEHHHCCCCHHHHHH
Q ss_conf             05100-10143000-012-0343156546567435752003774-87199999997739989999431025998799999
Q 537021.9.peg.1  104 KGEPI-LGSGRIFP-IVE-EDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA  179 (251)
Q Consensus       104 ~G~~~-~~~g~v~~-~~~-~~~~~~~~~~~~~~~~~~g~D~G~~-~p~a~~~~~~~~~~~~~~i~de~~~~~~t~~~~~~  179 (251)
                      .|.|. +++|+|+. .+. +...+.+.++.....+++|+||||+ +|+|+++++++++++.+||++|+|..+++++++++
T Consensus        17 ~g~~v~~g~g~v~fd~~~~~~~~i~d~ei~~~~~~~~GiDfG~~~dpta~v~~~~d~~~~~~yi~~E~y~~~~t~~~~a~   96 (212)
T 2wbn_A           17 RGSHMALGSGVVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAIDELVDHKVSLKRTAD   96 (212)
T ss_dssp             ----------CCSCTTEEECTTCSCHHHHHHCCCEEEEEECCBTTBCEEEEEEEEETTTTEEEEEEEEEESSCCHHHHHH
T ss_pred             CCCEEEECCCEEECCCCEEEECCCCHHHHHCCCCEEEEEECCCCCCCCEEEEEEEECCCCEEEEEEEHEECCCCHHHHHH
T ss_conf             78768852543633774787168896784056726997854999888589999998989999998721005899999999


Q ss_pred             HHHHCCCCCEEEECCCCCEECCCCCCCHHHHHHHCCCEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             998332487089726300111788888899999789747765777776777589989999998
Q 537021.9.peg.1  180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR  242 (251)
Q Consensus       180 ~i~~~~~~~~~~~~~~~~~~~~~~~~s~~e~~r~~G~~~~~~~~~~~kg~~sV~~GI~~l~~~  242 (251)
                      .|+++......      ...+++.+.++.++++++|++..++   .+|++++|++||+.|++.
T Consensus        97 ~i~~~~~~~~~------~~~~~a~~~~~~~~~~~~G~~~~~~---~~k~~~sv~~gi~~l~~~  150 (212)
T 2wbn_A           97 FVRKNKYESAR------IIADSSEPRSIDALKLEHGINRIEG---AKKGPDSVEHGERWLDEL  150 (212)
T ss_dssp             HHHHTTCTTSC------EEECTTCHHHHHHHHHTTCCTTEEE---CCSCGGGHHHHHHHHHTS
T ss_pred             HHHHHCCCCCE------EEECCCCHHHHHHHHHHCCCCEEEC---CCCCCCHHHHHHHHHHCC
T ss_conf             99974788875------9987888889999999789977754---667830599999999728



>3c6a_A Terminase large subunit; terminase nuclease, viral protein; 1.16A {Enterobacteria phage RB49} PDB: 3c6h_A Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 251
2wbn_A_212 (A:) G2P, terminase large subunit; large terminase 4e-16
>2wbn_A (A:) G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_ALength = 212 Back     alignment and structure
 Score = 79.6 bits (196), Expect = 4e-16
 Identities = 20/158 (12%), Positives = 44/158 (27%), Gaps = 15/158 (9%)

Query: 96  LHEREARTKGEPILGSGRIFP-IVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLV 153
                 R     +      F  +  E+ +I   ++        G+DFG+   P A     
Sbjct: 11  SSGLVPRGSHXALGSGVVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWH 70

Query: 154 WNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRR 213
           +++  + IY +      + +       ++         +    +  D      + A    
Sbjct: 71  YDKRKNRIYAIDELVDHKVSLKRTADFVRKNK------YESARIIADSSEPRSIDALKLE 124

Query: 214 QGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
            G+  +        G + VE G       +      V 
Sbjct: 125 HGINRIEGA---KKGPDSVEHGE----RWLDELDAIVI 155


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target251
2wbn_A_212 G2P, terminase large subunit; large terminase, nuc 99.9
3cpe_A_384-592209 Terminase, DNA packaging protein GP17; large termi 98.13
3c6a_A_232 Terminase large subunit; terminase nuclease, viral 97.62
3cpe_A_146-383238 Terminase, DNA packaging protein GP17; large termi 96.69
>2wbn_A (A:) G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_A Back     alignment and structure
Probab=99.90  E-value=4.1e-24  Score=149.21  Aligned_cols=148  Identities=14%  Similarity=0.132  Sum_probs=121.2

Q ss_pred             HHHCCCHHHHHHHHCCCCE--EECCCEEECCCC-EEECCCCCCCCCCEEEEEECCCCC-CCCEEEEEEEECCCCEEEEEE
Q ss_conf             9870897356433005100--101430000120-343156546567435752003774-871999999977399899994
Q 537021.9.peg.1   90 IIDSYPLHEREARTKGEPI--LGSGRIFPIVEE-DIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVK  165 (251)
Q Consensus        90 ~~~~~~~~~~~~~~~G~~~--~~~g~v~~~~~~-~~~~~~~~~~~~~~~~~g~D~G~~-~p~a~~~~~~~~~~~~~~i~d  165 (251)
                      .++.++++.|+++++|+|.  .++|.||..|++ .|++.++++++.+++++|+|||++ +|+|++++++++.++.+|+++
T Consensus         3 a~k~~dp~~y~~~~~G~~~~~~~~g~vy~~~~~~~~~i~~~~~~~~~~~~~g~D~G~~~~p~a~~~~~~~~~~~~~~i~~   82 (212)
T 2wbn_A            3 SSHHHHHHSSGLVPRGSHXALGSGVVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAID   82 (212)
T ss_dssp             ------------------------CCSCTTEEECTTCSCHHHHHHCCCEEEEEECCBTTBCEEEEEEEEETTTTEEEEEE
T ss_pred             CCCCCCCCCCCCCCCCCEEEECCCEEECCCCEEECCCCCHHHHHCCCCEEEEEECCCCCCCCEEEEEEEECCCCEEEEEE
T ss_conf             65444333456012687477515425058756852678867852356369977048998885899999978899899998


Q ss_pred             EHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCEECCCCCCCHHHHHHHCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             31025998799999998332487089726300111788888899999789747765777776777589989999998607
Q 537021.9.peg.1  166 NYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRS  245 (251)
Q Consensus       166 e~~~~~~t~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~s~~e~~r~~G~~~~~~~~~~~kg~~sV~~GI~~l~~~~~~  245 (251)
                      |+|.+++++.++++.|+++++...      ....|++.++++.++++++|+++.++.   ++++++|.+||+.    |++
T Consensus        83 e~~~~~~~~~~~a~~l~~~~~~~~------~~~~D~A~~~~i~~l~~~~G~~~~~a~---k~~~~~i~~~~~~----l~~  149 (212)
T 2wbn_A           83 ELVDHKVSLKRTADFVRKNKYESA------RIIADSSEPRSIDALKLEHGINRIEGA---KKGPDSVEHGERW----LDE  149 (212)
T ss_dssp             EEEESSCCHHHHHHHHHHTTCTTS------CEEECTTCHHHHHHHHHTTCCTTEEEC---CSCGGGHHHHHHH----HHT
T ss_pred             EEEECCCCHHHHHHHHHHHCCCCC------CCCCCCCCCCHHHHHHHHCCCCEEECC---CCCCCHHHHHHHH----HHH
T ss_conf             602158899999999997456877------531458773258999986897653125---5587709999999----982


Q ss_pred             CCCEE
Q ss_conf             99078
Q 537021.9.peg.1  246 GRWKV  250 (251)
Q Consensus       246 grl~V  250 (251)
                      ++..+
T Consensus       150 ~~~~~  154 (212)
T 2wbn_A          150 LDAIV  154 (212)
T ss_dssp             SSEEE
T ss_pred             CCCEE
T ss_conf             78734



>3cpe_A (A:384-592) Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3c6a_A (A:) Terminase large subunit; terminase nuclease, viral protein; 1.16A {Enterobacteria phage RB49} PDB: 3c6h_A Back     alignment and structure
>3cpe_A (A:146-383) Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure