P23396 RS3_HUMAN

Gene name: RPS3
Protein name: 40S ribosomal protein S3

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cell division GO:0051301
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome segregation GO:0007059
- cytoskeleton organization GO:0007010
- DNA metabolic process GO:0006259
- immune system process GO:0002376
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P20809 IL11 0.96461 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 Q9Y6U7 RNF215 0.96185 catabolic process GO:0009056
response to stress GO:0006950
3 P08254 MMP3 0.90966 catabolic process GO:0009056
cell death GO:0008219
cellular component assembly GO:0022607
...
4 A0A1B0GUC4 MYOCOS 0.88183
5 Q9Y6J3 SMAD5-AS1 0.87615 signal transduction GO:0007165
6 A0A1B0GUX0 ATP6V1FNB 0.8673
7 Q9NPA2 MMP25 0.84004 anatomical structure development GO:0048856
catabolic process GO:0009056
extracellular matrix organization GO:0030198
...
8 Q7Z7M8 B3GNT8 0.83965 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular protein modification process GO:0006464
9 Q3SX64 ODF3L2 0.83765
10 O43516 WIPF1 0.83292 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MAVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIA
STMI:                                                                                                                        
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDD................................................................................................
CONSENSUS:               DD..................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                 160                 180                 200
AA:                      QAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGP
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ..................................................................................................D.
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          220                 240                 
AA:                      KKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA
STMI:                                                               
DO_DISOPRED3:            ................DDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..DDDD..DDDD..DD..DDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................DDDDDDDDDDDDDDDD
RICH_[P]:                                  PttPiseqkggkPePPamPqPvP  
RICH_MOBI_[P]:                                         PePPamPqPvP  
RICH_fLPS_MOBI_[P]:                                    PePPamPqPvP