P33778 H2B1B_HUMAN
Gene name: H2BC3
Protein name: Histone H2B type 1-B
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q99877 | H2BC15 | 0.98431 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 2 | Q8N257 | H2BU1 | 0.9707 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 3 | P07305 | H1-0 | 0.94911 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 4 | Q16778 | H2BC21 | 0.94899 | cellular component assembly GO:0022607 chromosome organization GO:0051276 immune system process GO:0002376 ... |
| 5 | O60814 | H2BC12 | 0.9489 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 6 | P62807 | H2BC4 | 0.94321 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 7 | P23527 | H2BC17 | 0.94005 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 8 | Q93079 | H2BC9 | 0.93979 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 9 | Q99880 | H2BC13 | 0.92939 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 10 | Q5QNW6 | H2BC18 | 0.91335 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
20 40 60 80 100 AA: MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................DDDDDDD.D.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... RICH_[AK]: KsApApKKgsKKAitKAqKK RICH_[K]: KsapapKKgsKKaitKaqKKdgKKrK RICH_[KP]: PePsKsaPaPKKgsKKaitK RICH_[KR]: KdgKKRKRsR RICH_fLPS_[K]: KKgsKKaitKaqKKdgKKrK RICH_MOBI_[AK]: KsApApKKgsKKAitKAqKK RICH_MOBI_[K]: KsapapKKgsKKaitKaqKKdgKKrK RICH_fLPS_MOBI_[K]: KKgsKKaitKaqKKdgKKrK
120 AA: LLLPGELAKHAVSEGTKAVTKYTSSK STMI: DO_DISOPRED3: .........................D DO_IUPRED2A: .................DDD..DD.. DO_SPOTD: ...............DDDDDDDDDDD CONSENSUS: .................DDDDDDDDD CONSENSUS_MOBI: ..........................