Q8N257 H2B3B_HUMAN
Gene name: H2BU1
Protein name: Histone H2B type 3-B
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q99877 | H2BC15 | 0.9866 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 2 | P33778 | H2BC3 | 0.9707 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 3 | P07305 | H1-0 | 0.94277 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 4 | P23527 | H2BC17 | 0.94215 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 5 | Q93079 | H2BC9 | 0.94135 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 6 | Q99880 | H2BC13 | 0.9296 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 7 | O60814 | H2BC12 | 0.92211 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 8 | Q16778 | H2BC21 | 0.92057 | cellular component assembly GO:0022607 chromosome organization GO:0051276 immune system process GO:0002376 ... |
| 9 | Q5QNW6 | H2BC18 | 0.91547 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 10 | P62807 | H2BC4 | 0.91399 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
20 40 60 80 100 AA: MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................DDDDDDDDD....D..... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................D.............D.................. RICH_[AK]: KsApApKKgsKKAvtKAqKK RICH_[K]: KsapapKKgsKKavtKaqKKdgKKrK RICH_[KP]: PdPsKsaPaPKKgsKKavtK RICH_fLPS_[K]: KKgsKKavtKaqKKdgKKrK RICH_MOBI_[AK]: KsApApKKgsKKAvtKAqKK RICH_MOBI_[K]: KsapapKKgsKKavtKaqKKdgKKrKrgrK RICH_MOBI_[KR]: KdgKKRKRgRK RICH_fLPS_MOBI_[K]: KKgsKKavtKaqKKdgKKrKrgrK
120 AA: LLLPGELAKHAVSEGTKAVTKYTSSK STMI: DO_DISOPRED3: .........................D DO_IUPRED2A: .................DDD..DD.. DO_SPOTD: ...............DDDDDDDDDDD CONSENSUS: .................DDDDDDDDD CONSENSUS_MOBI: ..........................