Q99877 H2B1N_HUMAN

Gene name: H2BC15
Protein name: Histone H2B type 1-N

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N257 H2BU1 0.9866 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
2 P33778 H2BC3 0.98431 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
3 P23527 H2BC17 0.95435 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
4 Q93079 H2BC9 0.95387 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
5 Q99880 H2BC13 0.94507 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
6 P57053 H2BS1 0.94324 anatomical structure development GO:0048856
cellular component assembly GO:0022607
chromosome organization GO:0051276
...
7 O60814 H2BC12 0.93413 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
8 Q16778 H2BC21 0.93393 cellular component assembly GO:0022607
chromosome organization GO:0051276
immune system process GO:0002376
...
9 P07305 H1-0 0.93017 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
10 Q5QNW6 H2BC18 0.9279 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003

                                           20                  40                  60                  80                 100
AA:                      MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDDDD..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
RICH_[AK]:                    KsApApKKgsKKAvtKAqKK                                                                           
RICH_[K]:                     KsapapKKgsKKavtKaqKKdgKKrK                                                                     
RICH_[KP]:                PePsKsaPaPKKgsKKavtK                                                                               
RICH_[KR]:                                       KdgKKRKRsR                                                                  
RICH_fLPS_[K]:                      KKgsKKavtKaqKKdgKKrK                                                                     
RICH_MOBI_[AK]:               KsApApKKgsKKAvtKAqKK                                                                           
RICH_MOBI_[K]:                KsapapKKgsKKavtKaqKKdgKKrKrsrK                                                                 
RICH_MOBI_[KR]:                                  KdgKKRKRsRK                                                                 
RICH_fLPS_MOBI_[K]:                 KKgsKKavtKaqKKdgKKrKrsrK                                                                 

                                          120              
AA:                      LLLPGELAKHAVSEGTKAVTKYTSSK
STMI:                                              
DO_DISOPRED3:            .........................D
DO_IUPRED2A:             .................DDD..DD..
DO_SPOTD:                ...............DDDDDDDDDDD
CONSENSUS:               .................DDDDDDDDD
CONSENSUS_MOBI:          ..........................