A2RUT3 TMM89_HUMAN
Gene name: TMEM89
Protein name: Transmembrane protein 89
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P62280 | RPS11 | 0.73106 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
2 | Q8N8J6 | ZNF615 | 0.72761 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
3 | Q9BSM1 | PCGF1 | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
4 | Q9NWS0 | PIH1D1 | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
5 | Q8TF42 | UBASH3B | 0.63571 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
6 | O15194 | CTDSPL | 0.59481 | cell cycle GO:0007049 cellular protein modification process GO:0006464 mitotic cell cycle GO:0000278 |
7 | Q9UFF9 | CNOT8 | 0.58835 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
8 | O75290 | ZNF780A | 0.5849 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
9 | B7Z6K7 | ZNF814 | 0.57735 | |
10 | P0DO92 | CDIPTOSP | 0.56468 |
20 40 60 80 100 AA: MLHVLASLPLLLLLVTSASTHAWSRPLWYQVGLDLQPWGCQPKSVEGCRGGLSCPGYWLGPGASRIYPVAAVMITTTMLMICRKILQGRRRSQATKGEHP STMI: SSSSSSSSSSSSSSSSSSSSSSSS MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: ............................................................................................DDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDDD...................................................................DDDDDDDDDDDDDD CONSENSUS: ....................................... ......DDDDDDDD CONSENSUS_MOBI: ....................................... ....DDDDDDDDDD
120 140 AA: QVTTEPCGPWKRRAPISDHTLLRGVLHMLDALLVHIEGHLRHLATQRQIQIKGTSTQSG STMI: DO_DISOPRED3: ..................................................DDDDDDDDD DO_IUPRED2A: DDDDDDDDDD....................................DDD.DDDDDDDDD DO_SPOTD: DDDDDDDDD.DD..................................DDDDDDDDDDDDD CONSENSUS: DDDDDDDDD.....................................DDDDDDDDDDDDD CONSENSUS_MOBI: DDDDDDDDDD................................................. RICH_[IQ]: QIQIkgtstQ