A2RUT3 TMM89_HUMAN

Gene name: TMEM89
Protein name: Transmembrane protein 89

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P62280 RPS11 0.73106 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 Q8N8J6 ZNF615 0.72761 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q9BSM1 PCGF1 0.70711 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
4 Q9NWS0 PIH1D1 0.70711 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
5 Q8TF42 UBASH3B 0.63571 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
6 O15194 CTDSPL 0.59481 cell cycle GO:0007049
cellular protein modification process GO:0006464
mitotic cell cycle GO:0000278
7 Q9UFF9 CNOT8 0.58835 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...
8 O75290 ZNF780A 0.5849 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 B7Z6K7 ZNF814 0.57735
10 P0DO92 CDIPTOSP 0.56468

                                           20                  40                  60                  80                 100
AA:                      MLHVLASLPLLLLLVTSASTHAWSRPLWYQVGLDLQPWGCQPKSVEGCRGGLSCPGYWLGPGASRIYPVAAVMITTTMLMICRKILQGRRRSQATKGEHP
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSS                                       MMMMMMMMMMMMMMMMMMMMMMM              
DO_DISOPRED3:            DDDDDDDDDDDDDDDD....................................................................................
DO_IUPRED2A:             ............................................................................................DDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD...................................................................DDDDDDDDDDDDDD
CONSENSUS:                                       .......................................                       ......DDDDDDDD
CONSENSUS_MOBI:                                  .......................................                       ....DDDDDDDDDD

                                          120                 140 
AA:                      QVTTEPCGPWKRRAPISDHTLLRGVLHMLDALLVHIEGHLRHLATQRQIQIKGTSTQSG
STMI:                                                                               
DO_DISOPRED3:            ..................................................DDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDD....................................DDD.DDDDDDDDD
DO_SPOTD:                DDDDDDDDD.DD..................................DDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDD.....................................DDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDD.................................................
RICH_[IQ]:                                                              QIQIkgtstQ