A6NDL7 MT21E_HUMAN
Gene name: METTL21EP
Protein name: Putative methyltransferase-like protein 21E pseudogene
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9BXN2 | CLEC7A | 0.99994 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
2 | P51636 | CAV2 | 0.87215 |
anatomical structure development
GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 ... |
3 | Q70EL3 | USP50 | 0.78723 |
catabolic process
GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
4 | Q9HC24 | TMBIM4 | 0.77193 |
cell death
GO:0008219 signal transduction GO:0007165 |
5 | Q9P296 | C5AR2 | 0.74198 |
cell population proliferation
GO:0008283 cellular protein modification process GO:0006464 homeostatic process GO:0042592 ... |
6 | P14543 | NID1 | 0.64235 |
anatomical structure development
GO:0048856 cell adhesion GO:0007155 cell-cell signaling GO:0007267 ... |
7 | Q9Y5Z9 | UBIAD1 | 0.63571 |
biosynthetic process
GO:0009058 small molecule metabolic process GO:0044281 |
8 | Q8TCX1 | DYNC2LI1 | 0.63571 |
anatomical structure development
GO:0048856 cellular component assembly GO:0022607 cytoskeleton-dependent intracellular transport GO:0030705 ... |
9 | P30876 | POLR2B | 0.63048 |
biological process involved in symbiotic interaction
GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
10 | Q96A61 | TRIM52 | 0.61559 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
20 40 60 80 100
AA: MIHFNLLETQLTPLASFQEIMKKTSIYHLPSFHYLMDSEAQEDTREAYDDKQVVTEIMARCFIPTLITTTSWESFHFIGHEIRITEAMDCYGAVVWPSAL
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDD.DDDDD......D.DDDDDDDDDDDDDDDDDDDDDD..................................................
DO_IUPRED2A: .............................................D......................................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDD..................................................
CONSENSUS_MOBI: ....................................................................................................
RICH_[D]: DseaqeDtreayDD
RICH_[DY]: YlmDseaqeDtreaYDD
120 140 160 180 200
AA: VLCYFLETNAKQYNMVDKNVIEIGAGTGLVSIVASLLGAHVTATDLPELLGNLQYNISRNTKMKSKHLPQVKELSWGVALDTNFPRSSNNFDYILAADVV
STMI:
DO_DISOPRED3: ....................................................................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: ....................................................................................................
CONSENSUS: ....................................................................................................
CONSENSUS_MOBI: ....................................................................................................
220 240 260
AA: YAHPFLEELLITFDHLCKETTIILWAMKFRLEKENKFVDRFKELFDLEEISSFPSLNIKLYKAVKKNRRSV
STMI:
DO_DISOPRED3: ...................................................................DDDD
DO_IUPRED2A: .......................................................................
DO_SPOTD: ..................................................................DDDDD
CONSENSUS: ...................................................................DDDD
CONSENSUS_MOBI: .......................................................................