Q9HC24 LFG4_HUMAN
Gene name: TMBIM4
Protein name: Protein lifeguard 4
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6NDL7 | METTL21EP | 0.77193 | cellular protein modification process GO:0006464 |
| 2 | Q86YE8 | ZNF573 | 0.76822 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q9BXN2 | CLEC7A | 0.76491 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 4 | P62495 | ETF1 | 0.68232 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | P51636 | CAV2 | 0.61959 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 ... |
| 6 | Q70EL3 | USP50 | 0.55926 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 7 | Q14586 | ZNF267 | 0.5421 | anatomical structure development GO:0048856 |
| 8 | Q9P296 | C5AR2 | 0.52711 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 homeostatic process GO:0042592 ... |
| 9 | P30876 | POLR2B | 0.46283 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | P14543 | NID1 | 0.45633 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell-cell signaling GO:0007267 ... |
20 40 60 80 100 AA: MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: .D.................................................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDD................... ......... ........ CONSENSUS_MOBI: ...................................... ......... ........ RICH_[DY]: DprYprssieDDfnY
120 140 160 180 200 AA: LFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHS STMI: MMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .. .......... ... .... CONSENSUS_MOBI: .. .......... ... ....
220 AA: LMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK STMI: IIIIIIIIIIIIIIIIIIIII DO_DISOPRED3: ...................................DDD DO_IUPRED2A: ...................................... DO_SPOTD: ..................................DDDD CONSENSUS: ........ ......DDD CONSENSUS_MOBI: ........ .........