P51636 CAV2_HUMAN
Gene name: CAV2
Protein name: Caveolin-2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- extracellular matrix organization GO:0030198
- homeostatic process GO:0042592
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- plasma membrane organization GO:0007009
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BXN2 | CLEC7A | 0.87303 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 2 | A6NDL7 | METTL21EP | 0.87215 | cellular protein modification process GO:0006464 |
| 3 | P17987 | TCP1 | 0.78284 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 4 | Q70EL3 | USP50 | 0.69302 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 5 | Q9P296 | C5AR2 | 0.65318 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 homeostatic process GO:0042592 ... |
| 6 | Q9Y5Z9 | UBIAD1 | 0.61959 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 7 | Q9HC24 | TMBIM4 | 0.61959 | cell death GO:0008219 signal transduction GO:0007165 |
| 8 | P20848 | SERPINA2 | 0.61132 | |
| 9 | Q16659 | MAPK6 | 0.60417 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 10 | Q8NG06 | TRIM58 | 0.59064 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIA STMI: IIIIIIIIIIIIII DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D................................................................ DO_IUPRED2A: .....................................D.............................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS_MOBI: ...................................................................................... RICH_[D]: DvqlfmDDDsyshhsgleyaDpekfaD RICH_[DH]: DvqlfmDDDsysHHsgleyaD RICH_[DY]: DvqlfmDDDsYshhsgleYaDpekfaD
120 140 160 AA: GILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD STMI: IIIIIII DO_DISOPRED3: .............................................................D DO_IUPRED2A: .............................................................. DO_SPOTD: ...........................................................DDD CONSENSUS: ......................................................D CONSENSUS_MOBI: .......................................................