A8MWE9 EFCB8_HUMAN
Gene name: EFCAB8
Protein name: EF-hand calcium-binding domain-containing protein 8
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P62280 | RPS11 | 0.73106 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q8N8J6 | ZNF615 | 0.72761 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q9NWS0 | PIH1D1 | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 4 | Q8TF42 | UBASH3B | 0.63571 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | O15194 | CTDSPL | 0.59481 | cell cycle GO:0007049 cellular protein modification process GO:0006464 mitotic cell cycle GO:0000278 |
| 6 | Q9UFF9 | CNOT8 | 0.58835 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 7 | O75290 | ZNF780A | 0.5849 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | B7Z6K7 | ZNF814 | 0.57735 | |
| 9 | P0DO92 | CDIPTOSP | 0.56468 | |
| 10 | O15467 | CCL16 | 0.56103 | cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
20 40 60 80 100 AA: MSSEDLAEIPQLQKLSIPHGFQNKEAASSPTPSITLSQVPDLQPGSQLFTEIHLAKIEKMFEEDINSTGALGMDAFIKAMKKVLSSVSDEMLKELFLKVD STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. DO_IUPRED2A: D..................D..D....D.DDDDDDDDD.............................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[IQ]: IpQlQklsIphgfQ
120 140 AA: SDCEGFVTWQKYVDYMMREFQGKEDMRKSQYRLHFYLPMTVVPL STMI: DO_DISOPRED3: ............................................ DO_IUPRED2A: ............................................ DO_SPOTD: .....................................DDDDDDD CONSENSUS: ............................................ CONSENSUS_MOBI: ............................................