O00198 HRK_HUMAN

Gene name: HRK
Protein name: Activator of apoptosis harakiri

List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O60762 DPM1 0.78087 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
2 Q9H7R5 ZNF665 0.77324 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 P33681 CD80 0.76194 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
4 Q5JQF7 LINC01556 0.7581
5 Q15036 SNX17 0.7581 anatomical structure development GO:0048856
catabolic process GO:0009056
protein transport GO:0015031
...
6 Q9UNQ2 DIMT1 0.75593 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
7 Q6UXT8 ALKAL1 0.71347 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular protein modification process GO:0006464
...
8 Q9NRR3 CDC42SE2 0.70711 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
signal transduction GO:0007165
...
9 Q9NUL7 DDX28 0.70711 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
ribonucleoprotein complex assembly GO:0022618
...
10 O00339 MATN2 0.68519 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...

                                           20                  40                  60                  80         
AA:                      MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
STMI:                                                                                        MMMMMMMMMMMMMMMMMMM    
DO_DISOPRED3:            DD.........................................................D...............................
DO_IUPRED2A:             ..................................................DDDDDDD..................................
DO_SPOTD:                DDDDDDDDD........................................DDDDDDDDDDDD...........................DDD
CONSENSUS:               DD................................................DDDDDDDDDD........                   ....
CONSENSUS_MOBI:          ....................................................................                   ....
RICH_fLPS_[R]:                                                             RRRaRsRRap