O43543 XRCC2_HUMAN
Gene name: XRCC2
Protein name: DNA repair protein XRCC2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- cytoskeleton organization GO:0007010
- DNA metabolic process GO:0006259
- embryo development GO:0009790
- growth GO:0040007
- mitotic cell cycle GO:0000278
- reproduction GO:0000003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8TBH0 | ARRDC2 | 1 | protein transport GO:0015031 transport GO:0006810 |
| 2 | Q15118 | PDK1 | 1 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell death GO:0008219 ... |
| 3 | P31358 | CD52 | 0.99746 | homeostatic process GO:0042592 |
| 4 | O15520 | FGF10 | 0.99673 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q8TBY0 | RBM46 | 0.99315 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 6 | Q7Z7C7 | STRA8 | 0.95293 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 7 | P15907 | ST6GAL1 | 0.9445 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 8 | Q8N961 | ABTB2 | 0.87168 | |
| 9 | C9JLW8 | MCRIP1 | 0.86671 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | Q96CG3 | TIFA | 0.81305 | cellular component assembly GO:0022607 immune system process GO:0002376 protein-containing complex assembly GO:0065003 ... |
20 40 60 80 100 AA: MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRL STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDD............................................................................................. CONSENSUS: DDDDDD.............................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: SQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQ STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: KASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC STMI: DO_DISOPRED3: ..DDDDDDDDDDDDDDD............................................................... DO_IUPRED2A: ...DD........................................................................... DO_SPOTD: .DDDDDDDDDDDDDDD................................................................ CONSENSUS: ..DDDDDDDDDDDDDD................................................................ CONSENSUS_MOBI: ................................................................................ RICH_[S]: SSSSeepShaS RICH_fLPS_[S]: SSSSeepShaS