O95190 OAZ2_HUMAN
Gene name: OAZ2
Protein name: Ornithine decarboxylase antizyme 2
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- protein transport GO:0015031
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZTR6 | ZNF516-DT | 0.77324 | |
| 2 | Q9Y3D2 | MSRB2 | 0.74329 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 3 | Q8NHX9 | TPCN2 | 0.74029 | catabolic process GO:0009056 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 4 | Q13253 | NOG | 0.73106 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q9UK05 | GDF2 | 0.725 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | Q8WW36 | ZCCHC13 | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 7 | Q9Y263 | PLAA | 0.70711 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 8 | Q9NZ38 | IDI2-AS1 | 0.70711 | |
| 9 | Q6UW01 | CBLN3 | 0.67267 | |
| 10 | P54652 | HSPA2 | 0.67204 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MINTQDSSILPLSNCPQLQCCRHIVPGPLWCSDAPHPLSKIPGGRGGGRDPSLSALIYKDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQ STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................D..DDDDDDDDDDDDDD.................................................. DO_IUPRED2A: ........................................DDDDD....................................................... DO_SPOTD: DDDDDDDDDDDDDDD.....................DD.DDDDDDDDDDDDD................................................ CONSENSUS: DDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDD.................................................. CONSENSUS_MOBI: .................................................................................................... RICH_fLPS_[G]: skipGGrGGG
120 140 160 180 AA: SLFVEIPDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYPLDQNLSDED STMI: DO_DISOPRED3: ...................................................................................DDDDDD DO_IUPRED2A: ......................................................................................... DO_SPOTD: ...................................................................................DDDDDD CONSENSUS: ...................................................................................DDDDDD CONSENSUS_MOBI: .........................................................................................