O96000 NDUBA_HUMAN
Gene name: NDUFB10
Protein name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- generation of precursor metabolites and energy GO:0006091
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | A6NMB1 | SIGLEC16 | 0.83844 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 |
2 | Q6DD88 | ATL3 | 0.8064 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
3 | Q8N4F7 | RNF175 | 0.8 | catabolic process GO:0009056 response to stress GO:0006950 signal transduction GO:0007165 |
4 | Q7RTP0 | NIPA1 | 0.76194 | transmembrane transport GO:0055085 transport GO:0006810 |
5 | Q96S52 | PIGS | 0.75569 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
6 | Q96B86 | RGMA | 0.74329 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
7 | Q9HCM9 | TRIM39 | 0.74329 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
8 | Q69YW2 | STUM | 0.74329 | |
9 | Q9UFG5 | C19orf25 | 0.73106 | |
10 | Q08AG7 | MZT1 | 0.73106 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
20 40 60 80 100 AA: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIM STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: .....DDDDDDDDD.D.................................................................................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: QDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS STMI: DO_DISOPRED3: ..........................................................DDDDDDDDDDDDDD DO_IUPRED2A: ............................................................DDDD....DDD. DO_SPOTD: ...........................................................DDDDDDDDDDDDD CONSENSUS: ...........................................................DDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................................ RICH_fLPS_[A]: rkAAkeAAAA