Q08AG7 MZT1_HUMAN
Gene name: MZT1
Protein name: Mitotic-spindle organizing protein 1
List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q08AG7 | MZT1 | 1 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 2 | P17655 | CAPN2 | 1 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | P0DMW5 | SMIM10L2B | 0.99996 | |
| 4 | Q9HCM9 | TRIM39 | 0.99984 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 5 | Q69YW2 | STUM | 0.99984 | |
| 6 | Q96B86 | RGMA | 0.99984 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 7 | Q9NUP9 | LIN7C | 0.99941 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 protein transport GO:0015031 ... |
| 8 | Q99471 | PFDN5 | 0.99941 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell-cell signaling GO:0007267 ... |
| 9 | Q9NVX2 | NLE1 | 0.99941 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 10 | Q96S52 | PIGS | 0.99932 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
20 40 60 80 AA: MASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD..........................................................DDDDDDDDD DO_IUPRED2A: .............................................................................D..D. DO_SPOTD: DDDDDDDDDDDDDDDDD.........................................................DDDDDDDD CONSENSUS: DDDDDDDDDDDDDDD...........................................................DDDDDDDD CONSENSUS_MOBI: .................................................................................. RICH_[A]: AsssgAgAAAAAAA RICH_fLPS_[A]: mAsssgAgAAAAAAA