P04908 H2A1B_HUMAN
Gene name: H2AC4
Protein name: Histone H2A type 1-B/E
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P20671 | H2AC7 | 0.99224 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 2 | Q96QV6 | H2AC1 | 0.73738 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 3 | Q96T55 | KCNK16 | 0.73267 | transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | P62917 | RPL8 | 0.69001 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q8NEG7 | DENND6B | 0.68972 | |
| 6 | Q96KK5 | H2AC12 | 0.68646 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 7 | P0C0S5 | H2AZ1 | 0.66205 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 8 | Q8WY22 | BRI3BP | 0.65882 | |
| 9 | Q14624 | ITIH4 | 0.63861 | response to stress GO:0006950 small molecule metabolic process GO:0044281 transport GO:0006810 ... |
| 10 | Q6FI13 | H2AC18 | 0.63639 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
20 40 60 80 100 AA: MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDD.DD...................................................D.D....DD................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: GrGkqGGkArAkAktrssrAG RICH_[AK]: KqggKArAKAKtrssrA RICH_[AR]: RgkqggkARAkAktRssRA RICH_[K]: KqggKaraKaK RICH_[R]: RgkqggkaRakaktRssR RICH_[GK]: GrGKqGGKaraKaKtrssraG RICH_[GR]: GRGkqGGkaRakaktRssRaG RICH_[KR]: RgKqggKaRaKaKtRssR
120 AA: VTIAQGGVLPNIQAVLLPKKTESHHKAKGK STMI: DO_DISOPRED3: ....................DDDDDDDDDD DO_IUPRED2A: ...................DDDDDDDDDDD DO_SPOTD: ..................DDDDDDDDDDDD CONSENSUS: ...................DDDDDDDDDDD CONSENSUS_MOBI: .............................D RICH_[HK]: KtesHHKaKgK