P20671 H2A1D_HUMAN

Gene name: H2AC7
Protein name: Histone H2A type 1-D

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P04908 H2AC4 0.99224 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
...
2 Q96T55 KCNK16 0.75063 transmembrane transport GO:0055085
transport GO:0006810
3 P62917 RPL8 0.71377 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 Q8NEG7 DENND6B 0.71179
5 Q96QV6 H2AC1 0.69919 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
6 Q96KK5 H2AC12 0.68976 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
7 Q8WY22 BRI3BP 0.67798
8 Q14624 ITIH4 0.65781 response to stress GO:0006950
small molecule metabolic process GO:0044281
transport GO:0006810
...
9 Q6FI13 H2AC18 0.64137 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
10 P0C0S5 H2AZ1 0.63075 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276

                                           20                  40                  60                  80                 100
AA:                      MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD...................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDD.DD...................................................D.D....DD.................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD..............................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDD..............................................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AG]:                 GrGkqGGkArAkAktrssrA                                                                              
RICH_[AK]:                    KqggKArAKAKtrssrA                                                                              
RICH_[AR]:                  RgkqggkARAkAktRssRA                                                                              
RICH_[K]:                     KqggKaraKaK                                                                                    
RICH_[R]:                   RgkqggkaRakaktRssR                                                                               
RICH_[GK]:                 GrGKqGGKaraKaK                                                                                    
RICH_[GR]:                 GRGkqGGkaRakaktRssR                                                                               
RICH_[KR]:                  RgKqggKaRaKaKtRssR                                                                               

                                          120          
AA:                      VTIAQGGVLPNIQAVLLPKKTESHHKAKGK
STMI:                                                  
DO_DISOPRED3:            ....................DDDDDDDDDD
DO_IUPRED2A:             ...................DD.DDDDDDDD
DO_SPOTD:                ..................DDDDDDDDDDDD
CONSENSUS:               ...................DDDDDDDDDDD
CONSENSUS_MOBI:          .............................D
RICH_[HK]:                                  KtesHHKaKgK