Q96QV6 H2A1A_HUMAN
Gene name: H2AC1
Protein name: Histone H2A type 1-A
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P04908 | H2AC4 | 0.73738 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | P20671 | H2AC7 | 0.69919 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 3 | Q11130 | FUT7 | 0.66089 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 4 | Q96BI1 | SLC22A18 | 0.66079 | transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | O95484 | CLDN9 | 0.65919 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 6 | Q9H9A6 | LRRC40 | 0.65903 | |
| 7 | Q92466 | DDB2 | 0.64788 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 8 | Q9HBE4 | IL21 | 0.64551 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 9 | P62753 | RPS6 | 0.63656 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | Q15388 | TOMM20 | 0.62669 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDD..D...................................................D.D...DDD................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDD....................................................................................... RICH_[RS]: RakSkSRSSR RICH_[K]: KqggKaraKsK RICH_[R]: RgkqggkaRaksksRssR RICH_[GK]: GrGKqGGKaraKsKsrssraG RICH_[GR]: GRGkqGGkaRaksksRssRaG RICH_[KR]: RgKqggKaRaKsKsRssR
120 AA: VTIAQGGVLPNIQAVLLPKKTESHHHKAQSK STMI: DO_DISOPRED3: ....................DDDDDDDDDDD DO_IUPRED2A: ..................DDDDDDDDDDDDD DO_SPOTD: ..................DDDDDDDDDDDDD CONSENSUS: ..................DDDDDDDDDDDDD CONSENSUS_MOBI: ....................DDDDDDDDDDD