P0C0S5 H2AZ_HUMAN
Gene name: H2AZ1
Protein name: Histone H2A.Z
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q71UI9 | H2AZ2 | 0.82013 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 2 | Q9Y5G9 | PCDHGA4 | 0.72259 | cell adhesion GO:0007155 reproduction GO:0000003 |
| 3 | Q8NI60 | COQ8A | 0.68519 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 4 | P04908 | H2AC4 | 0.66205 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q5VTE0 | EEF1A1P5 | 0.66007 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 6 | Q9NXB9 | ELOVL2 | 0.63782 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 7 | P20671 | H2AC7 | 0.63075 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 8 | A0PJW8 | DAPL1 | 0.62985 | catabolic process GO:0009056 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | Q9H6D3 | XKR8 | 0.62493 | anatomical structure development GO:0048856 cell death GO:0008219 membrane organization GO:0061024 ... |
| 10 | P17568 | NDUFB7 | 0.5896 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
20 40 60 80 100 AA: MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDD..D......DDDDDDDDDDDDDDDDD....................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: DDDDDDDDDD.......................................................................................... RICH_[AG]: AGGkAGkdsGkAktkA RICH_[AK]: AggKAgKdsgKAKtKA RICH_[K]: KagKdsgKaKtK RICH_[GK]: GGKaGKdsGKaKtK
120 AA: IKATIAGGGVIPHIHKSLIGKKGQQKTV STMI: DO_DISOPRED3: ................DDDDDDDDDDDD DO_IUPRED2A: .....................D..D... DO_SPOTD: ....................DDDDDDDD CONSENSUS: ....................DDDDDDDD CONSENSUS_MOBI: .....................DDDDDDD