P09683 SECR_HUMAN

Gene name: SCT
Protein name: Secretin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- catabolic process GO:0009056
- cell-cell signaling GO:0007267
- embryo development GO:0009790
- homeostatic process GO:0042592
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P15941 MUC1 0.94492 biosynthetic process GO:0009058
cell adhesion GO:0007155
cell cycle GO:0007049
...
2 Q9NQ31 AKIP1 0.89443 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
3 P56746 CLDN15 0.88492 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
...
4 Q96GV9 MACIR 0.87416 cellular component assembly GO:0022607
protein transport GO:0015031
response to stress GO:0006950
...
5 A6NH21 SERINC4 0.81373 biosynthetic process GO:0009058
6 O43555 GNRH2 0.81347 anatomical structure development GO:0048856
reproduction GO:0000003
signal transduction GO:0007165
7 Q93038 TNFRSF25 0.80779 cell death GO:0008219
signal transduction GO:0007165
8 O14531 DPYSL4 0.79947 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
9 Q69YG0 TMEM42 0.78087
10 Q14164 IKBKE 0.76877 biological process involved in symbiotic interaction GO:0044403
cell death GO:0008219
cellular protein modification process GO:0006464
...

                                           20                  40                  60                  80                 100
AA:                      MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWL
STMI:                    SSSSSSSSSSSSSSSSSS                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD.......................................DDD..................................
DO_IUPRED2A:             ...................DDDDDDDDDDDDDDDDDDD............DDDDDDD..DDD.DD..................................D
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................DDDDDDDDDDDD.DD.D.....................DD..DDD
CONSENSUS:                                 DDDDDDDDDDDDD........................DDDDDDDDDDD.................................D
CONSENSUS_MOBI:                            ..................................................................................

                                          120                   
AA:                      PPGPMVSEPAGAAAEGTLRPR
STMI:                                         
DO_DISOPRED3:            .......DDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .....................
RICH_[AP]:               PPgPmvsePAgAAAegtlrP