P19652 A1AG2_HUMAN
Gene name: ORM2
Protein name: Alpha-1-acid glycoprotein 2
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- immune system process GO:0002376
- protein transport GO:0015031
- response to stress GO:0006950
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O75578 | ITGA10 | 0.98969 | cell adhesion GO:0007155 extracellular matrix organization GO:0030198 signal transduction GO:0007165 |
| 2 | Q9UJG1 | MOSPD1 | 0.90228 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q96L12 | CALR3 | 0.89186 | cell differentiation GO:0030154 protein folding GO:0006457 reproduction GO:0000003 ... |
| 4 | Q9UI26 | IPO11 | 0.88134 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 5 | P01137 | TGFB1 | 0.88081 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | Q9UKJ5 | CHIC2 | 0.88081 | |
| 7 | Q96RQ3 | MCCC1 | 0.88081 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 8 | P42857 | NSG1 | 0.88074 | cell death GO:0008219 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
| 9 | Q07817 | BCL2L1 | 0.87878 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 10 | Q86XI2 | NCAPG2 | 0.87626 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQ STMI: SSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDD..................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS: .................................................................................. CONSENSUS_MOBI: ..................................................................................
120 140 160 180 200 AA: RENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGE STMI: DO_DISOPRED3: ..........................................................................................DDDDDDDDDD DO_IUPRED2A: .......D.............................................................................DDDDDDDDDDDDDDD DO_SPOTD: ....................................................................................DDDDDDDDDDDDDDDD CONSENSUS: .....................................................................................DDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................................................................DDDD RICH_[E]: EkqhEkErkqEEgE RICH_[EK]: EKqhEKErKqE RICH_fLPS_[E]: lEkqhEkErkqEEgE
AA: S STMI: DO_DISOPRED3: D DO_IUPRED2A: D DO_SPOTD: D CONSENSUS: D CONSENSUS_MOBI: D