P34130 NTF4_HUMAN
Gene name: NTF4
Protein name: Neurotrophin-4
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell death GO:0008219
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- nervous system process GO:0050877
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q86Y38 | XYLT1 | 0.98454 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 developmental maturation GO:0021700 ... |
| 2 | Q8TAQ9 | SUN3 | 0.88492 | membrane organization GO:0061024 |
| 3 | P0CG22 | DHRS4L1 | 0.77193 | |
| 4 | Q04844 | CHRNE | 0.73994 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 5 | Q9UMS0 | NFU1 | 0.70711 | cellular component assembly GO:0022607 protein maturation GO:0051604 |
| 6 | Q9BWD3 | RTL8A | 0.67267 | |
| 7 | Q9H106 | SIRPD | 0.66602 | |
| 8 | Q96Q05 | TRAPPC9 | 0.62471 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | Q9H845 | ACAD9 | 0.60401 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 small molecule metabolic process GO:0044281 |
| 10 | P26373 | RPL13 | 0.54375 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAV STMI: SSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD....................................DDDDDDDDDDDDDDDDDDDDDD................ DO_IUPRED2A: ..........................DD............................................DDDDDDDDDDDDDD.............. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................DDDDDDDDDDDDDDDDDDDDDD.......... CONSENSUS: DDDD........................................DDDDDDDDDDDDDDDDDD.............. CONSENSUS_MOBI: ............................................................................ RICH_[AR]: AgApAnRsRR
120 140 160 180 200 AA: SGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACV STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .......................D......................DDDD.DDDDDDDD......................................... DO_SPOTD: .............................................DDD.................................................... CONSENSUS: ..............................................DD.................................................... CONSENSUS_MOBI: ....................................................................................................
AA: CTLLSRTGRA STMI: DO_DISOPRED3: .......DDD DO_IUPRED2A: .......... DO_SPOTD: .......DDD CONSENSUS: .......DDD CONSENSUS_MOBI: ..........