P61081 UBC12_HUMAN
Gene name: UBE2M
Protein name: NEDD8-conjugating enzyme Ubc12
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O14807 | MRAS | 0.94013 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 2 | Q9BZA0 | TTTY10 | 0.93983 | |
| 3 | Q9NYL4 | FKBP11 | 0.93983 | |
| 4 | Q8N9C0 | IGSF22 | 0.93983 | |
| 5 | Q8WW27 | APOBEC4 | 0.93916 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 6 | Q00059 | TFAM | 0.93674 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q14CX7 | NAA25 | 0.93674 | cellular protein modification process GO:0006464 protein maturation GO:0051604 |
| 8 | Q9HAW9 | UGT1A8 | 0.93379 | carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 9 | P62979 | RPS27A | 0.93379 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | P60002 | ELOF1 | 0.93256 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
20 40 60 80 100 AA: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVY STMI: DO_DISOPRED3: D.....DD..DDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: ............DDDDDDDDDDD............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: D.....DDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: ...............DDDDD................................................................................ RICH_[K]: KqqKKeeesaggtKgssKK RICH_[EG]: EEEsaGGtkG RICH_fLPS_[K]: lKqqKKeeesaggtKgssKK
120 140 160 180 AA: HPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK STMI: DO_DISOPRED3: ................................................................................... DO_IUPRED2A: ..............................................DDD.................................. DO_SPOTD: ................................................................................... CONSENSUS: ................................................................................... CONSENSUS_MOBI: ...................................................................................