P62899 RL31_HUMAN
Gene name: RPL31
Protein name: 60S ribosomal protein L31
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UK45 | LSM7 | 0.92308 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 2 | P62834 | RAP1A | 0.83205 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 3 | O95347 | SMC2 | 0.81923 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 4 | P60002 | ELOF1 | 0.8064 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 5 | Q14CX7 | NAA25 | 0.78087 | cellular protein modification process GO:0006464 protein maturation GO:0051604 |
| 6 | Q00059 | TFAM | 0.78087 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q8WW27 | APOBEC4 | 0.75569 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 8 | O14807 | MRAS | 0.72336 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 9 | Q00013 | MPP1 | 0.71247 | immune system process GO:0002376 signal transduction GO:0007165 |
| 10 | Q9NYL4 | FKBP11 | 0.70711 |
20 40 60 80 100 AA: MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPN STMI: DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDD.................................D.....................................DDDDDDDD.D... DO_SPOTD: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS_MOBI: DDDDDDDDDDD......................................................................................... RICH_fLPS_[K]: paKKggeKKK
120 AA: KLYTLVTYVPVTTFKNLQTVNVDEN STMI: DO_DISOPRED3: ........................D DO_IUPRED2A: ........................D DO_SPOTD: ....................DDDDD CONSENSUS: ........................D CONSENSUS_MOBI: ........................D