List of terms from Generic GO subset, which this protein is a part of:
- generation of precursor metabolites and energy GO:0006091

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q8IWX5	SGPP2	0.91037	biosynthetic process GO:0009058 cell population proliferation GO:0008283 small molecule metabolic process GO:0044281
2	Q02978	SLC25A11	0.79262	biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281
3	Q96FZ5	CMTM7	0.78273	anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376
4	Q9NWH2	TMEM242	0.75258
5	Q6UW01	CBLN3	0.73994
6	P37287	PIGA	0.73279	biosynthetic process GO:0009058 cellular protein modification process GO:0006464
7	A6NFF2	NAP1L6P	0.7313	cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003
8	O95295	SNAPIN	0.7282	anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ...
9	Q5T6F0	DCAF12	0.71758	cellular protein modification process GO:0006464
10	Q9Y664	KPTN	0.70711	cytoskeleton organization GO:0007010 response to stress GO:0006950 signal transduction GO:0007165

                                           20                  40                  60                  80   
AA:                      MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
STMI:                    TTTTTTTTTTTT                                                                                     
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDD..........................................................................D
DO_IUPRED2A:             .............DDDD.D........................................DD.D.....................DDDD...DDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDD..........................DDDDD........................................D.
CONSENSUS:                           DDDDDDDDDD.........................................................................DD
CONSENSUS_MOBI:                      .....................................................................................
RICH_[AG]:                           AsAAkGGhGG