Q0P5N6 ARL16_HUMAN
Gene name: ARL16
Protein name: ADP-ribosylation factor-like protein 16
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IWX5 | SGPP2 | 0.91037 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 small molecule metabolic process GO:0044281 |
| 2 | Q02978 | SLC25A11 | 0.79262 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 3 | Q96FZ5 | CMTM7 | 0.78273 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 |
| 4 | Q9NWH2 | TMEM242 | 0.75258 | |
| 5 | Q6UW01 | CBLN3 | 0.73994 | |
| 6 | P37287 | PIGA | 0.73279 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 7 | A6NFF2 | NAP1L6P | 0.7313 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 8 | O95295 | SNAPIN | 0.7282 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 9 | Q5T6F0 | DCAF12 | 0.71758 | cellular protein modification process GO:0006464 |
| 10 | Q99836 | MYD88 | 0.70711 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
20 40 60 80 100 AA: MRVAGGRALSRGAELRVPGGAKHGMCLLLGATGVGKTLLVKRLQEVSSRDGKGDLGEPPPTRPTVGTNLTDIVAQRKITIRELGGCMGPIWSSYYGNCRS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: ................................................DDDDDDDDDDDDDDDDDDDD................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: AGGrAlsrGA
120 140 160 180 AA: LLFVMDASDPTQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND STMI: DO_DISOPRED3: ...............................................................................................DD DO_IUPRED2A: ................................................................................................. DO_SPOTD: ..............................................................................................DDD CONSENSUS: ...............................................................................................DD CONSENSUS_MOBI: .................................................................................................