Q14129 DGCR6_HUMAN
Gene name: DGCR6
Protein name: Protein DGCR6
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q8IWX5 | SGPP2 | 0.91037 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 small molecule metabolic process GO:0044281 |
2 | Q02978 | SLC25A11 | 0.79262 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
3 | Q96FZ5 | CMTM7 | 0.78273 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 |
4 | Q9NWH2 | TMEM242 | 0.75258 | |
5 | Q6UW01 | CBLN3 | 0.73994 | |
6 | P37287 | PIGA | 0.73279 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
7 | A6NFF2 | NAP1L6P | 0.7313 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
8 | O95295 | SNAPIN | 0.7282 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
9 | Q5T6F0 | DCAF12 | 0.71758 | cellular protein modification process GO:0006464 |
10 | Q9Y664 | KPTN | 0.70711 | cytoskeleton organization GO:0007010 response to stress GO:0006950 signal transduction GO:0007165 |
20 40 60 80 100 AA: MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKH STMI: DO_DISOPRED3: DDDDDDDDDDDDD....................................................................................... DO_IUPRED2A: ...............................................................................................D.... DO_SPOTD: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS: DDDDDDDDDDDDD....................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: QEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGL STMI: DO_DISOPRED3: ............................................................................................DDDDDDDD DO_IUPRED2A: ..DD..D..................D.DDD...................................................................... DO_SPOTD: ............................................................................................DDDDDDDD CONSENSUS: ............................................................................................DDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: AGkAAlGl