Q5T4I8 CF052_HUMAN
Gene name: C6orf52
Protein name: Putative uncharacterized protein C6orf52
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q86VI1 | EXOC3L1 | 0.66473 | cell-cell signaling GO:0007267 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 2 | Q9BT04 | FUZ | 0.66473 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 3 | Q53FP2 | TMEM35A | 0.66473 | |
| 4 | Q7RTS6 | OTOP2 | 0.63551 | transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | P31994 | FCGR2B | 0.61718 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 6 | Q9Y226 | SLC22A13 | 0.59743 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 7 | Q8N402 | n/a | 0.59455 | |
| 8 | O95866 | MPIG6B | 0.58823 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 9 | Q9H840 | GEMIN7 | 0.57295 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 10 | Q9UKJ0 | PILRB | 0.55977 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
20 40 60 80 100 AA: MAQPESSADFGIAQQNNYYCYWQSLPSAIRVKQEFQPSQSYRYGNWYARQHGSYLLSGYSYGCAVDGNGKDCFSAHETPEHTAGTLVMPKETTPLAENQD STMI: DO_DISOPRED3: DDDDDDD.D..........................................................................D.D......D.DDDDDD DO_IUPRED2A: D...DDD................................................................D.DDDD.D.DDDDDDDDDDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDD.....................................................DDDDD...DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDD..............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[T]: TpehTagTlvmpkeTT RICH_[DE]: EnqD RICH_[EP]: PkEttPlaEnqd RICH_[HT]: HeTpeHTagT
120 140 AA: EDPLEDPHLHLNIEESNQEFMVKSEELYDSLMNCHWQPLDTVHSEIPDETPK STMI: DO_DISOPRED3: ................................................DDDD DO_IUPRED2A: DDDDDDDDDDDDD.DD........................DDDDDDDDDDDD DO_SPOTD: DDDDDDDD................................DDDDDDDDDDDD CONSENSUS: DDDDDDDD................................DDDDDDDDDDDD CONSENSUS_MOBI: .................................................... RICH_[DE]: EDplED RICH_[EP]: EdPlEdP