Q6XXX2 CU024_HUMAN
Gene name: LINC00114
Protein name: Putative uncharacterized protein encoded by LINC00114
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BQI0 | AIF1L | 0.74257 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 2 | Q14626 | IL11RA | 0.73601 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165 |
| 3 | Q96QK8 | SMIM14 | 0.72316 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 4 | P60606 | CTXN1 | 0.72316 | |
| 5 | Q16613 | AANAT | 0.71685 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 6 | A0PG75 | PLSCR5 | 0.71224 | membrane organization GO:0061024 plasma membrane organization GO:0007009 transport GO:0006810 |
| 7 | Q8N2S1 | LTBP4 | 0.70795 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 8 | Q14451 | GRB7 | 0.69532 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | Q8TE67 | EPS8L3 | 0.69473 | cellular component assembly GO:0022607 signal transduction GO:0007165 |
| 10 | Q9BQ13 | KCTD14 | 0.692 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
20 40 60 80 100 AA: MQTTWQPGCSYPTSWLSSQESFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLTPTLSSARPREGSCPSKCSCPGGNWSNTALS STMI: DO_DISOPRED3: DD.................................................D....D...D....................................... DO_IUPRED2A: ...................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................ DO_SPOTD: DDDD.DDDDD....................DD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................. CONSENSUS: DD....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................ CONSENSUS_MOBI: .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............ RICH_[P]: PhsPravssPathslPPsnP RICH_[R]: RaRnRekphspR RICH_MOBI_[P]: PhsPravssPathslPPsnP RICH_MOBI_[R]: RwRnRaRnRekphspR RICH_fLPS_MOBI_[R]: lRwRnRaRnR RICH_fLPS_MOBI_[C]: CrltptlssarpregsCpskC
120 AA: AELMWAEGRFSGGCLPVYMRQNINPGCQEQWEGEERSRWL STMI: DO_DISOPRED3: ......................................DD DO_IUPRED2A: .........................D.DD........D.. DO_SPOTD: ...........................DDDDDDDDDDDDD CONSENSUS: ...........................DD........DDD CONSENSUS_MOBI: ........................................