Q6XXX2 CU024_HUMAN

Gene name: LINC00114
Protein name: Putative uncharacterized protein encoded by LINC00114

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BQI0 AIF1L 0.74257 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
2 Q14626 IL11RA 0.73601 anatomical structure development GO:0048856
cell population proliferation GO:0008283
signal transduction GO:0007165
3 Q96QK8 SMIM14 0.72316 anatomical structure development GO:0048856
embryo development GO:0009790
4 P60606 CTXN1 0.72316
5 Q16613 AANAT 0.71685 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
6 A0PG75 PLSCR5 0.71224 membrane organization GO:0061024
plasma membrane organization GO:0007009
transport GO:0006810
7 Q8N2S1 LTBP4 0.70795 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
8 Q14451 GRB7 0.69532 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 Q8TE67 EPS8L3 0.69473 cellular component assembly GO:0022607
signal transduction GO:0007165
10 Q9BQ13 KCTD14 0.692 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003

                                           20                  40                  60                  80                 100
AA:                      MQTTWQPGCSYPTSWLSSQESFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLTPTLSSARPREGSCPSKCSCPGGNWSNTALS
STMI:                                                                                                                        
DO_DISOPRED3:            DD.................................................D....D...D.......................................
DO_IUPRED2A:             ...................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
DO_SPOTD:                DDDD.DDDDD....................DD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................
CONSENSUS:               DD....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
CONSENSUS_MOBI:          .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
RICH_[P]:                                                              PhsPravssPathslPPsnP                                  
RICH_[R]:                                                       RaRnRekphspR                                                 
RICH_MOBI_[P]:                                                         PhsPravssPathslPPsnP                                  
RICH_MOBI_[R]:                                              RwRnRaRnRekphspR                                                 
RICH_fLPS_MOBI_[R]:                                        lRwRnRaRnR                                                        
RICH_fLPS_MOBI_[C]:                                                                        CrltptlssarpregsCpskC             

                                          120
AA:                      AELMWAEGRFSGGCLPVYMRQNINPGCQEQWEGEERSRWL
STMI:                                                            
DO_DISOPRED3:            ......................................DD
DO_IUPRED2A:             .........................D.DD........D..
DO_SPOTD:                ...........................DDDDDDDDDDDDD
CONSENSUS:               ...........................DD........DDD
CONSENSUS_MOBI:          ........................................