Q9BTE7 DCNL5_HUMAN
Gene name: DCUN1D5
Protein name: DCN1-like protein 5
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5VTE0 | EEF1A1P5 | 0.85623 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 2 | Q8NI60 | COQ8A | 0.8548 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 3 | Q9NXB9 | ELOVL2 | 0.8175 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 4 | Q9H6D3 | XKR8 | 0.7885 | anatomical structure development GO:0048856 cell death GO:0008219 membrane organization GO:0061024 ... |
| 5 | P17568 | NDUFB7 | 0.72848 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
| 6 | Q71UI9 | H2AZ2 | 0.72424 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 7 | Q9NVR7 | TBCCD1 | 0.72291 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 |
| 8 | P21741 | MDK | 0.68194 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | Q9NV29 | TMEM100 | 0.67737 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 10 | O43615 | TIMM44 | 0.67394 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
20 40 60 80 100 AA: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGF STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... DO_IUPRED2A: D................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AC]: AAAvAedgglkkCkissyC RICH_[AK]: KKKrKspgvAAAvAedgglKKcK RICH_[K]: KKKrKspgvaaavaedgglKKcK
120 140 160 180 200 AA: FTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNV STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: LEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS STMI: DO_DISOPRED3: ....................................D DO_IUPRED2A: ..................................... DO_SPOTD: ...................................DD CONSENSUS: ....................................D CONSENSUS_MOBI: .....................................