Q86UP9 LHPL3_HUMAN
Gene name: LHFPL3
Protein name: LHFPL tetraspan subfamily member 3 protein
List of terms from Generic GO subset, which this protein is a part of:
- nervous system process GO:0050877
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BQ87 | TBL1Y | 0.91919 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 2 | P52888 | THOP1 | 0.85472 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 3 | Q99873 | PRMT1 | 0.82707 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 4 | Q9NUP9 | LIN7C | 0.8165 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 protein transport GO:0015031 ... |
| 5 | Q9NVX2 | NLE1 | 0.8165 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 6 | Q99471 | PFDN5 | 0.8165 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell-cell signaling GO:0007267 ... |
| 7 | P0DMW5 | SMIM10L2B | 0.81623 | |
| 8 | P17655 | CAPN2 | 0.81601 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | Q9UFG5 | C19orf25 | 0.81601 | |
| 10 | Q9HCM9 | TRIM39 | 0.81537 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
20 40 60 80 100 AA: MPGAAAAAAAAAAAMLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQAGYFGLFHYCIGNGFSRELTCRGSFTDFSTL STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDD................ ............................................ CONSENSUS_MOBI: ................................... ............................................ RICH_[AM]: MpgAAAAAAAAAAAM RICH_[A]: AAAAAAAAAAAmlpA RICH_fLPS_[A]: AAAAAAAAAAAmlpA
120 140 160 180 200 AA: PSGAFKAASFFIGLSMMLIIACIICFTLFFFCNTATVYKICAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAIIGILDA STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ......... ......... .............................. CONSENSUS_MOBI: ......... ......... ..............................
220 AA: LILSFLAFVLGNRQDSLMAEELKAENKVLLSQYSLE STMI: MMMMMMMMMMM DO_DISOPRED3: .........DDD......DDD...D..DDDDDD.DD DO_IUPRED2A: .................................... DO_SPOTD: .............DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .......DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .........................