Q86UY6 NAA40_HUMAN
Gene name: NAA40
Protein name: N-alpha-acetyltransferase 40
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- protein maturation GO:0051604
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BYD6 | MRPL1 | 0.64865 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
| 2 | O14818 | PSMA7 | 0.64637 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 3 | O14604 | TMSB4Y | 0.63487 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
| 4 | Q14331 | FRG1 | 0.6161 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 5 | A0A1B0GVZ9 | TMEM269 | 0.61487 | |
| 6 | Q05901 | CHRNB3 | 0.60459 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 7 | P62328 | TMSB4X | 0.58749 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | P42677 | RPS27 | 0.58229 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | P60002 | ELOF1 | 0.57847 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 10 | O95347 | SMC2 | 0.57833 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
20 40 60 80 100 AA: MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREE STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDD................................................................................D.... DO_SPOTD: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KssKaKeKKqK RICH_[EK]: KEKKqKrlEE RICH_fLPS_[K]: mgrKssKaKeKKqKr
120 140 160 180 200 AA: MTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPS STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: MSGCCGEDCSYEILSRRTKFGDSHHSHAGGHCGGCCH STMI: DO_DISOPRED3: .....................DDDDDDDDDDDDDDDD DO_IUPRED2A: ..................................... DO_SPOTD: ....................DDDDDDDDDDDDDDDDD CONSENSUS: .....................DDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..................................... RICH_[H]: HHsHaggHcggccH RICH_[CH]: HHsHaggHCggCCH RICH_[GH]: HHsHaGGHcGGccH