P57053 H2BFS_HUMAN
Gene name: H2BS1
Protein name: Histone H2B type F-S
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q93079 | H2BC9 | 0.98445 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 2 | P23527 | H2BC17 | 0.9844 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 3 | Q5QNW6 | H2BC18 | 0.95855 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 4 | Q16778 | H2BC21 | 0.95178 | cellular component assembly GO:0022607 chromosome organization GO:0051276 immune system process GO:0002376 ... |
| 5 | O60814 | H2BC12 | 0.94829 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 6 | P62807 | H2BC4 | 0.94365 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 7 | Q99877 | H2BC15 | 0.94324 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 8 | Q8N257 | H2BU1 | 0.91032 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 9 | P33778 | H2BC3 | 0.909 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 10 | Q99880 | H2BC13 | 0.89707 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
20 40 60 80 100 AA: MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDDDD.D........ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ RICH_[AK]: AKsApApKKgsKKAvtKAqKK RICH_[AP]: PePAksAPAPkkgskkA RICH_[K]: KsapapKKgsKKavtKaqKKdgrKrK RICH_[KP]: PePaKsaPaPKKgsKKavtK RICH_[KR]: KKavtKaqKKdgRKRKRsR RICH_fLPS_[K]: KKgsKKavtKaqKKdgrKrK RICH_MOBI_[AK]: AKsApApKKgsKKAvtKAqKK RICH_MOBI_[AP]: PePAksAPAP RICH_MOBI_[K]: KsapapKKgsKKavtKaqKKdgrKrKrsrK RICH_MOBI_[KR]: KKavtKaqKKdgRKRKRsRK RICH_fLPS_MOBI_[K]: KKgsKKavtKaqKKdgrKrKrsrK
120 AA: LLLPGELAKHAVSEGTKAVTKYTSAK STMI: DO_DISOPRED3: .........................D DO_IUPRED2A: .............D....D...D... DO_SPOTD: ...............DDDDDDDDDDD CONSENSUS: ..................DDDDDDDD CONSENSUS_MOBI: ..........................