Q8IZQ5 SELH_HUMAN
Gene name: SELENOH
Protein name: Selenoprotein H
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q86Y38 | XYLT1 | 0.98454 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 developmental maturation GO:0021700 ... |
| 2 | Q8TAQ9 | SUN3 | 0.88492 | membrane organization GO:0061024 |
| 3 | P0CG22 | DHRS4L1 | 0.77193 | |
| 4 | Q04844 | CHRNE | 0.73994 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 5 | Q9UMS0 | NFU1 | 0.70711 | cellular component assembly GO:0022607 protein maturation GO:0051604 |
| 6 | Q9BWD3 | RTL8A | 0.67267 | |
| 7 | Q9H106 | SIRPD | 0.66602 | |
| 8 | Q96Q05 | TRAPPC9 | 0.62471 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | Q9H845 | ACAD9 | 0.60401 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 small molecule metabolic process GO:0044281 |
| 10 | P26373 | RPL13 | 0.54375 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MAPRGRKRKAEAAVVAVAEKREKLANGGEGMEEATVVIEHCTSURVYGRNAAALSQALRLEAPELPVKVNPTKPRRGSFEVTLLRPDGSSAELWTGIKKG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_IUPRED2A: DDDDDDD.DDDDD......DDDDDDDDDDDDDDDDD...........................DDDDDDDDDD..DDDDDDDD........DDDDD...D DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS: DDDDDDDDDDDDD......DDDDDDDDDDD...................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AR]: RgRkRkAeAA
120 AA: PPRKLKFPEPQEVVEELKKYLS STMI: DO_DISOPRED3: ...................... DO_IUPRED2A: DD..DDDDDD............ DO_SPOTD: ...................... CONSENSUS: ...................... CONSENSUS_MOBI: ......................